(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE84

PENCW_16.PE84        Location/Qualifiers
FT   CDS             complement(186091..187497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128435"
FT                   /orf_name="Pc20g00840"
FT                   /product="Pc20g00840 protein"
FT                   /protein_id="CAP85413.1"
FT                   /db_xref="UniParc:UPI0001831C74"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD4"
FT                   /transl_table=1
FT                   /translation="MSTQSPHSPTPKGSRNNRRPQKKNTTPHAQKPALLSTPPSSPPRN
FT                   MSSGAIQVDPSNNFNSSKKKPMRSGKKSRDNKASPAPHSGYHSNGYNSGPRHTPSRPAV
FT                   TSPQTKPSPAYAGPTFHASPAPSALPIPSFFSKSAPDANLVPPMETDSDDADVDPELEM
FT                   TPSKPRNRNNQSKGEEPKPSPLDFLFKAAVQARDQKSTSSPEVNKVLQSPQTEPRVVRP
FT                   NADGMFTFEMGNSDYNRNSNIGPSFAPSYQDRMNALRPSSTPQSPDMTEEERRTKTEEL
FT                   KHLLLNPPPQKPPSSAYASPEYAGPFGSRPSNVPPYATPMRTSSGPQLTASHGSFSSPQ
FT                   LQQQQISQNNGRRHYQYPTHSHSPLRREVDMVPPPSMPPYRGPVSNNTSNGGSPAPYGN
FT                   PYMTMSQQQQQQQQSGYASPHPDYAPSSFQIPVNSPSPSRVVDTAQIENDIRRVLKLDA
FT                   SGPPVTQSSA"
     MSTQSPHSPT PKGSRNNRRP QKKNTTPHAQ KPALLSTPPS SPPRNMSSGA IQVDPSNNFN        60
     SSKKKPMRSG KKSRDNKASP APHSGYHSNG YNSGPRHTPS RPAVTSPQTK PSPAYAGPTF       120
     HASPAPSALP IPSFFSKSAP DANLVPPMET DSDDADVDPE LEMTPSKPRN RNNQSKGEEP       180
     KPSPLDFLFK AAVQARDQKS TSSPEVNKVL QSPQTEPRVV RPNADGMFTF EMGNSDYNRN       240
     SNIGPSFAPS YQDRMNALRP SSTPQSPDMT EEERRTKTEE LKHLLLNPPP QKPPSSAYAS       300
     PEYAGPFGSR PSNVPPYATP MRTSSGPQLT ASHGSFSSPQ LQQQQISQNN GRRHYQYPTH       360
     SHSPLRREVD MVPPPSMPPY RGPVSNNTSN GGSPAPYGNP YMTMSQQQQQ QQQSGYASPH       420
     PDYAPSSFQI PVNSPSPSRV VDTAQIENDI RRVLKLDASG PPVTQSSA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page