(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE85

PENCW_16.PE85        Location/Qualifiers
FT   CDS             join(188262..188366,188422..188500,188562..188632,
FT                   188698..188796)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977343"
FT                   /orf_name="Pc20g00850"
FT                   /product="Pc20g00850 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85414.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831C75"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD5"
FT                   /transl_table=1
FT                   /translation="MTDVEMKEAATGSSKGKAVAKGSDNADKKKFEVKKWNAVALWAWD
FT                   IVVDNCAICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCP
FT                   LDNRDWEFQKYGR"
     MTDVEMKEAA TGSSKGKAVA KGSDNADKKK FEVKKWNAVA LWAWDIVVDN CAICRNHIMD        60
     LCIECQANQG SSTTEECTVA WGICNHAFHF HCISRWLKTR QVCPLDNRDW EFQKYGR          117
//

If you have problems or comments...

PBIL Back to PBIL home page