(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE86

PENCW_16.PE86        Location/Qualifiers
FT   CDS             join(complement(189470..189517),complement(189331..189390),
FT                   complement(189072..189269))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171962" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128436"
FT                   /orf_name="Pc20g00860"
FT                   /product="Pc20g00860 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAP85415.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniParc:UPI0001831C76"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD6"
FT                   /transl_table=1
FT                   /translation="MDELLAPIQDVIEGQIDFHGQRLAELLSTVLLVISGAASFVIGYI
FT                   YQDIHLTLWTGLAGTLFTAFVVVPPWPVYNRNPEKWLGSTSANAAPGITVDGVKVQ"
     MDELLAPIQD VIEGQIDFHG QRLAELLSTV LLVISGAASF VIGYIYQDIH LTLWTGLAGT        60
     LFTAFVVVPP WPVYNRNPEK WLGSTSANAA PGITVDGVKV Q                           101
//

If you have problems or comments...

PBIL Back to PBIL home page