(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE87

PENCW_16.PE87        Location/Qualifiers
FT   CDS             join(complement(190997..191414),complement(190588..190886),
FT                   complement(190187..190531))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977344"
FT                   /orf_name="Pc20g00870"
FT                   /product="Pc20g00870 protein"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85416.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001831C77"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD7"
FT                   /transl_table=1
FT                   /translation="MSSFVIKIPCSSANIGPGFDVIGLALSLHLDLHVTIEAKPSSQEP
FT                   FNCAITYEDQSKSVEQISLDPEVNLITRVALYVLRCHDQRAFPVETKVHIVNPIPLGRG
FT                   LGSSGTAVVAGVMLGNEVGKLGLSKERLLDYCLMIERHPDNVAASLFGGFVGTYLNELK
FT                   PEDVARKEIPLSEVLPAPAGGVDTGIRPPEPPMAIGHYRKFNWAPEIKAIAIIPDFVVP
FT                   TANARNVLPQSYSREDVVFNLQRAALLPAALGSSPPDPDMIFLAMQDKVHQPYRKTLIP
FT                   GLTEILQFMTPATQPGLLGICLSGAGPTILALATERFTEIADRIIAQFASNGISCQWKL
FT                   LEPAHDGATVAYN"
     MSSFVIKIPC SSANIGPGFD VIGLALSLHL DLHVTIEAKP SSQEPFNCAI TYEDQSKSVE        60
     QISLDPEVNL ITRVALYVLR CHDQRAFPVE TKVHIVNPIP LGRGLGSSGT AVVAGVMLGN       120
     EVGKLGLSKE RLLDYCLMIE RHPDNVAASL FGGFVGTYLN ELKPEDVARK EIPLSEVLPA       180
     PAGGVDTGIR PPEPPMAIGH YRKFNWAPEI KAIAIIPDFV VPTANARNVL PQSYSREDVV       240
     FNLQRAALLP AALGSSPPDP DMIFLAMQDK VHQPYRKTLI PGLTEILQFM TPATQPGLLG       300
     ICLSGAGPTI LALATERFTE IADRIIAQFA SNGISCQWKL LEPAHDGATV AYN              353
//

If you have problems or comments...

PBIL Back to PBIL home page