(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE88

PENCW_16.PE88        Location/Qualifiers
FT   CDS             192852..194792
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946707"
FT                   /orf_name="Pc20g00880"
FT                   /product="Pc20g00880 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85417.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001831C78"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD8"
FT                   /transl_table=1
FT                   /translation="MSESPRSERYMYLTRYSTPVPELDDHRLQMQTPPRIEVPVERSYS
FT                   PHDTTQGPEILDRPDLLSAQDARRDGPIPRDFEKVDDNRSLNELNGLGRRFSVDHNATY
FT                   QTPRRISIVNPDLANASAASSVSARSSSPPNSVEAFADPRRRERANTLDSHAPPDLEAI
FT                   LQRTVSGGTHNRRPTFSNASAIHPQLGDVPFDTAEEACFEEPGRIPVIDYEELEEFVAL
FT                   NPSIKVADADRRKYSMSSQSKRPRIFYDLRPGAESPEIGAIKKNGSSDTLSEDEKKNAA
FT                   VTDEKERFKTRQNVNQRSRFGFFSSESQSTVHAADLGDLVLPGETFRDLFELGPEGGVW
FT                   WLDVANPTDEELGAISRAFSIHPLTTEDIQTQEAREKVELFKQYYFVCFRTFFQTDKTS
FT                   EEFLEPVNFYMVVFRDGVLTFSFEDNPHAANVRKRIGKLRDYVALSSDWICYAMIDDIV
FT                   DSFGPVIRDVELESEAIEDHVFIARVDDFESFLPRIGGLRKKVMSLMRLLGGKADVIRG
FT                   FSKRCNEQYSVTPRGDIGLYLGDIQDHVVTMMSNLAHFEKMLSRSHTNYLAQLNVTNLV
FT                   LGNHVNKVLSKVTLIATILVPMNLITGLFGMNVEVPGQHTDGLNWWFGILGVIAGIVVV
FT                   SFGLARWQKLV"
     MSESPRSERY MYLTRYSTPV PELDDHRLQM QTPPRIEVPV ERSYSPHDTT QGPEILDRPD        60
     LLSAQDARRD GPIPRDFEKV DDNRSLNELN GLGRRFSVDH NATYQTPRRI SIVNPDLANA       120
     SAASSVSARS SSPPNSVEAF ADPRRRERAN TLDSHAPPDL EAILQRTVSG GTHNRRPTFS       180
     NASAIHPQLG DVPFDTAEEA CFEEPGRIPV IDYEELEEFV ALNPSIKVAD ADRRKYSMSS       240
     QSKRPRIFYD LRPGAESPEI GAIKKNGSSD TLSEDEKKNA AVTDEKERFK TRQNVNQRSR       300
     FGFFSSESQS TVHAADLGDL VLPGETFRDL FELGPEGGVW WLDVANPTDE ELGAISRAFS       360
     IHPLTTEDIQ TQEAREKVEL FKQYYFVCFR TFFQTDKTSE EFLEPVNFYM VVFRDGVLTF       420
     SFEDNPHAAN VRKRIGKLRD YVALSSDWIC YAMIDDIVDS FGPVIRDVEL ESEAIEDHVF       480
     IARVDDFESF LPRIGGLRKK VMSLMRLLGG KADVIRGFSK RCNEQYSVTP RGDIGLYLGD       540
     IQDHVVTMMS NLAHFEKMLS RSHTNYLAQL NVTNLVLGNH VNKVLSKVTL IATILVPMNL       600
     ITGLFGMNVE VPGQHTDGLN WWFGILGVIA GIVVVSFGLA RWQKLV                      646
//

If you have problems or comments...

PBIL Back to PBIL home page