(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE9

PENCW_16.PE9         Location/Qualifiers
FT   CDS             join(complement(28359..28502),complement(27948..28316),
FT                   complement(27837..27881))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128431"
FT                   /orf_name="Pc20g00090"
FT                   /product="Pc20g00090 protein"
FT                   /protein_id="CAP85338.1"
FT                   /db_xref="UniParc:UPI000183182F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER7"
FT                   /transl_table=1
FT                   /translation="MMPPSDSLRHQLHKLAEVRASRNTSSISTSTPTSTSTPGTAPPPY
FT                   TLSNDMDDPWASPINIYIDHSITVTGDENTIMVSSPGMDSPTDPTHQEAPRLSSIAAVI
FT                   IAALNRANALHDDMGYPRPVNIRALAGIRVNGRNNRVCVGGEINKSQNETADAGVRESN
FT                   GRKRRASSEPVDAPSAQRSRSF"
     MMPPSDSLRH QLHKLAEVRA SRNTSSISTS TPTSTSTPGT APPPYTLSND MDDPWASPIN        60
     IYIDHSITVT GDENTIMVSS PGMDSPTDPT HQEAPRLSSI AAVIIAALNR ANALHDDMGY       120
     PRPVNIRALA GIRVNGRNNR VCVGGEINKS QNETADAGVR ESNGRKRRAS SEPVDAPSAQ       180
     RSRSF                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page