(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE90

PENCW_16.PE90        Location/Qualifiers
FT   CDS             complement(197868..198476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671394"
FT                   /orf_name="Pc20g00900"
FT                   /product="Pc20g00900 protein"
FT                   /protein_id="CAP85419.1"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI0001831C7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE0"
FT                   /transl_table=1
FT                   /translation="MSIETSESETASLATPIKTPAAEEEEEKEKDTCRPSIYSPANLLS
FT                   SLLSPFSFSSTSPESTTTTSPNNDKDKEKEKTKSPSKISIETPTSASTQSTPEPYYTPE
FT                   ETPLFKTLYKTRLTKTRTKQLLRAGERGYDDPPPPPGLGDCCGSSCDPCVRDLWKQEIG
FT                   IWRERWGDRGVEDGVGVSTDEKKSEKKEEKLAKRKDLEW"
     MSIETSESET ASLATPIKTP AAEEEEEKEK DTCRPSIYSP ANLLSSLLSP FSFSSTSPES        60
     TTTTSPNNDK DKEKEKTKSP SKISIETPTS ASTQSTPEPY YTPEETPLFK TLYKTRLTKT       120
     RTKQLLRAGE RGYDDPPPPP GLGDCCGSSC DPCVRDLWKQ EIGIWRERWG DRGVEDGVGV       180
     STDEKKSEKK EEKLAKRKDL EW                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page