(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE91

PENCW_16.PE91        Location/Qualifiers
FT   CDS             complement(199003..200487)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946709"
FT                   /orf_name="Pc20g00910"
FT                   /product="Pc20g00910 protein"
FT                   /protein_id="CAP85420.1"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniParc:UPI0001831C7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE1"
FT                   /transl_table=1
FT                   /translation="MASSSSQELVKQSAGQLMPPPPPPKRIKRPATVLDEDVYTNTLSH
FT                   IIARDFFPGLLETQIKQEYLEALESKDKSWIASSKKKLADVMRTPTPGSNARRKSDYAS
FT                   VPSTPQHFPAGRAGDTPHGWGGDTPMSVISTSTSATETQDRNIPDVSNMGLVAFQAKYT
FT                   SEDNESFNKVLDKQNEKRREKYPWLWSGNKVPSARQIAHHQQEIKRITAQGGKPEMGLI
FT                   KRDEHVQSAIKTDLDARPAKPNSWKSRPDNTLMFLPSSVEDTHETLAQKAEITSRAGPK
FT                   RTLYQNTRLLDPHAAAAADAANAVPPSPSLSAIQDAIAGRPHLSESEAASAFAGSETPR
FT                   VNGYAFVDEDEPEPEFTYGSSSKTDDDMEADWRLLGPTSEKPNPFQLGETRKREALHHR
FT                   MVDRVARNKRAEKAARVTKTPVSLTPRFASSPRLDFGSASTPGAGSSRGSVYAGGHQGK
FT                   MLTPAAQKLLQQVGTPRPRERKSGLGNAWTPTPKRK"
     MASSSSQELV KQSAGQLMPP PPPPKRIKRP ATVLDEDVYT NTLSHIIARD FFPGLLETQI        60
     KQEYLEALES KDKSWIASSK KKLADVMRTP TPGSNARRKS DYASVPSTPQ HFPAGRAGDT       120
     PHGWGGDTPM SVISTSTSAT ETQDRNIPDV SNMGLVAFQA KYTSEDNESF NKVLDKQNEK       180
     RREKYPWLWS GNKVPSARQI AHHQQEIKRI TAQGGKPEMG LIKRDEHVQS AIKTDLDARP       240
     AKPNSWKSRP DNTLMFLPSS VEDTHETLAQ KAEITSRAGP KRTLYQNTRL LDPHAAAAAD       300
     AANAVPPSPS LSAIQDAIAG RPHLSESEAA SAFAGSETPR VNGYAFVDED EPEPEFTYGS       360
     SSKTDDDMEA DWRLLGPTSE KPNPFQLGET RKREALHHRM VDRVARNKRA EKAARVTKTP       420
     VSLTPRFASS PRLDFGSAST PGAGSSRGSV YAGGHQGKML TPAAQKLLQQ VGTPRPRERK       480
     SGLGNAWTPT PKRK                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page