(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE94

PENCW_16.PE94        Location/Qualifiers
FT   CDS             join(complement(209539..209880),complement(208904..209040),
FT                   complement(208344..208647))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946710"
FT                   /orf_name="Pc20g00940"
FT                   /product="Putative uncharacterized protein Pc20g00940 "
FT                   /protein_id="CAP85423.1"
FT                   /db_xref="UniParc:UPI0001831D4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ8"
FT                   /transl_table=1
FT                   /translation="MRYALIAPVLLAATALAVPVPNQGDVSVANRDVGDGIDAAADANV
FT                   SGDASVNVKRDGGDGIDADAELSGDVSADVKRDGGNDIDADAELSGDVSADVKRDGGDG
FT                   IDADVDADADYTKEERELTISNSLPFVCLLFGSFRRAQTRKSHVSQICLQNERSPLLIH
FT                   SPQDSSNGRIHMYFTQIGDRWIVAQAKRIARYATLNYNLRSPSSGRDTVAIDFEGTEYG
FT                   VARNITTGVGDQLLVSGELDLSILGKHEEERVRDRRTM"
     MRYALIAPVL LAATALAVPV PNQGDVSVAN RDVGDGIDAA ADANVSGDAS VNVKRDGGDG        60
     IDADAELSGD VSADVKRDGG NDIDADAELS GDVSADVKRD GGDGIDADVD ADADYTKEER       120
     ELTISNSLPF VCLLFGSFRR AQTRKSHVSQ ICLQNERSPL LIHSPQDSSN GRIHMYFTQI       180
     GDRWIVAQAK RIARYATLNY NLRSPSSGRD TVAIDFEGTE YGVARNITTG VGDQLLVSGE       240
     LDLSILGKHE EERVRDRRTM                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page