(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE95

PENCW_16.PE95        Location/Qualifiers
FT   CDS             210768..211541
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128439"
FT                   /orf_name="Pc20g00950"
FT                   /product="Pc20g00950 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85424.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831D50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ9"
FT                   /transl_table=1
FT                   /translation="MEICEKAEAFVDQDDDIVFDHTRLILRRDNEYFYARTDWRILDLH
FT                   PSAADISQLELNKIPMENVWPPMDPRFTPAPDPLPPNCYVKQPSLLYYSDTPASLEPAR
FT                   QVLAEVEACEVLQQHPHPNIAQYFGCVTMDGKITGLCFHKYPITLSQKLKEATPFDKAF
FT                   CLEGIESGVRHMHSLGLIHNDLNPRNIMMDGERPVIIDFDSCKREGDELGLKAGTSGWE
FT                   LEGIIYAKPENDYFGLSKIREIMIGGEDGKPEEQS"
     MEICEKAEAF VDQDDDIVFD HTRLILRRDN EYFYARTDWR ILDLHPSAAD ISQLELNKIP        60
     MENVWPPMDP RFTPAPDPLP PNCYVKQPSL LYYSDTPASL EPARQVLAEV EACEVLQQHP       120
     HPNIAQYFGC VTMDGKITGL CFHKYPITLS QKLKEATPFD KAFCLEGIES GVRHMHSLGL       180
     IHNDLNPRNI MMDGERPVII DFDSCKREGD ELGLKAGTSG WELEGIIYAK PENDYFGLSK       240
     IREIMIGGED GKPEEQS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page