(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE96

PENCW_16.PE96        Location/Qualifiers
FT   CDS             join(complement(215671..216525),complement(212858..215596))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946711"
FT                   /orf_name="Pc20g00960"
FT                   /product="Pc20g00960 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85425.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831D51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR0"
FT                   /transl_table=1
FT                   /translation="MAPLENGQTNGLNGDAVPPASPLNNLRFSDIPDAIDIPASSFDSE
FT                   VEVSLLELPDDPTELCTLLENEKAAKNFWVIIALAYAKRKQIDHAIDILTKGLASVAHG
FT                   ATKEKLGLLGWICWMLLLKSRHAPRVAPEGELYSEAKTKDHYLQLATSTLNEASRLNPA
FT                   YPPLFLARGVLCLLRASLYPPRAVRPGAVDTSERVESLRQALKCFDESSKAFGGRNIMA
FT                   ILGRARAHYMLGRYADALEGYQKALIKMPNLTDPDPRIGLGCCLWQLGFKDQAKVAWER
FT                   SLSLNPESKVANVLLAVYYLHDSSRRATTDPMFGSMYKLAMTQYTQKAFKLDKEYPMTC
FT                   SMFASYFLLRKQYPTVETLARKAIEHTDVMSIASDGWYLLGRKSHYEGDNARAAEFYNR
FT                   SDQARGGVDKGYLPAKFGAVQMQITNKDFDGAKFRLEKIVQQSKNPEAMTLLAAIHAEE
FT                   VFAAQKSGSKEDKSTETKRAITLLESVRSMWKDEKQNISPDESVLVYLSRLYEGTAPDK
FT                   SMQCLTQLEQIQIAEIPEDARPDIEDQEKMNAALRESLPPQLLNNMGCFLYQNDKIALA
FT                   RGLFQSALNACVQSKEKEDGTDTDALVTTISYNLGRTYEAADMWDEAKKVYEGLLERHS
FT                   DYTEANARLTYIALRQSPTDEGPKKIGKLYEAESTNLEVRSLYGWYLSKAKKRVANLAE
FT                   DSEQRHFKHTLQYYDKHDRYALTGMGNVHLLAARDMRRDTDQEKEKRRKIYQRAVEFFD
FT                   KALQLDPKNAYAAQGIAIALVDDKKDHSSAVQILSKIRDTIKDPSVYLNLGHVFAELRQ
FT                   FSRSIEHYETALSKDRQRDVQILACLGRVWWLRGKQEANLAAMKTALDYATRARDIAPD
FT                   QLHLQFNVAFVQNQIASLAYGLQPTQKTLQDVQEAAEGLKEAIETFERLSKEKNPPYPS
FT                   AALEQRANMGRTISKQLDRAMQSQKEYEEKNAAKLQQAREAREAAARVREEELRKAQEV
FT                   EMERKKRIAEERAQMVEEVQRHALQRAEEERAREEAELTHDSETGDRVKRKKKPASKRK
FT                   KKGGDDFIADEGEGEAAHSAAESEGEAPKKRRRLGRRSGGKAQVDKPEKPGKYKSSEMV
FT                   VDSDDEEAARSAGEDKDDMFGDDEEPAEEAAPRRRGKASRRIADEDEDEDEDEEVQQEV
FT                   QAEKSVHEDDKDDDLFGEEPSKTTEDTEMQE"
     MAPLENGQTN GLNGDAVPPA SPLNNLRFSD IPDAIDIPAS SFDSEVEVSL LELPDDPTEL        60
     CTLLENEKAA KNFWVIIALA YAKRKQIDHA IDILTKGLAS VAHGATKEKL GLLGWICWML       120
     LLKSRHAPRV APEGELYSEA KTKDHYLQLA TSTLNEASRL NPAYPPLFLA RGVLCLLRAS       180
     LYPPRAVRPG AVDTSERVES LRQALKCFDE SSKAFGGRNI MAILGRARAH YMLGRYADAL       240
     EGYQKALIKM PNLTDPDPRI GLGCCLWQLG FKDQAKVAWE RSLSLNPESK VANVLLAVYY       300
     LHDSSRRATT DPMFGSMYKL AMTQYTQKAF KLDKEYPMTC SMFASYFLLR KQYPTVETLA       360
     RKAIEHTDVM SIASDGWYLL GRKSHYEGDN ARAAEFYNRS DQARGGVDKG YLPAKFGAVQ       420
     MQITNKDFDG AKFRLEKIVQ QSKNPEAMTL LAAIHAEEVF AAQKSGSKED KSTETKRAIT       480
     LLESVRSMWK DEKQNISPDE SVLVYLSRLY EGTAPDKSMQ CLTQLEQIQI AEIPEDARPD       540
     IEDQEKMNAA LRESLPPQLL NNMGCFLYQN DKIALARGLF QSALNACVQS KEKEDGTDTD       600
     ALVTTISYNL GRTYEAADMW DEAKKVYEGL LERHSDYTEA NARLTYIALR QSPTDEGPKK       660
     IGKLYEAEST NLEVRSLYGW YLSKAKKRVA NLAEDSEQRH FKHTLQYYDK HDRYALTGMG       720
     NVHLLAARDM RRDTDQEKEK RRKIYQRAVE FFDKALQLDP KNAYAAQGIA IALVDDKKDH       780
     SSAVQILSKI RDTIKDPSVY LNLGHVFAEL RQFSRSIEHY ETALSKDRQR DVQILACLGR       840
     VWWLRGKQEA NLAAMKTALD YATRARDIAP DQLHLQFNVA FVQNQIASLA YGLQPTQKTL       900
     QDVQEAAEGL KEAIETFERL SKEKNPPYPS AALEQRANMG RTISKQLDRA MQSQKEYEEK       960
     NAAKLQQARE AREAAARVRE EELRKAQEVE MERKKRIAEE RAQMVEEVQR HALQRAEEER      1020
     AREEAELTHD SETGDRVKRK KKPASKRKKK GGDDFIADEG EGEAAHSAAE SEGEAPKKRR      1080
     RLGRRSGGKA QVDKPEKPGK YKSSEMVVDS DDEEAARSAG EDKDDMFGDD EEPAEEAAPR      1140
     RRGKASRRIA DEDEDEDEDE EVQQEVQAEK SVHEDDKDDD LFGEEPSKTT EDTEMQE         1197
//

If you have problems or comments...

PBIL Back to PBIL home page