(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE97

PENCW_16.PE97        Location/Qualifiers
FT   CDS             join(complement(217379..218238),complement(216925..217312))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946712"
FT                   /orf_name="Pc20g00970"
FT                   /product="Pc20g00970 protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAP85426.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI0001831D52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR1"
FT                   /transl_table=1
FT                   /translation="MEPTEVRQRKPPTTKDAGELQKLSTKPPSEPRLKHGIPMQILRSL
FT                   LLITWADCCIMAICVTQLIGCPLYLINRYYYYSYMAYTKQCFGLVLGSVTQWSSPTLFR
FT                   VSGDASVRGQIHLSKDGLLETRFPERLVMISNHQVYTDWVYLWWVAYTNQMHGRIFIIL
FT                   KESLKYIPIVGTGMMFYGFIFMARKWMSDKPRLQHRLDKLKTAYTGSNSARPQYDPMWL
FT                   LIFPEGTNLSINTKRRSDIWGEKQGLPSFKHVILPRSTGLFFCLQQLRGTVDWVYDCTM
FT                   AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMHWRRFQVSKIPLDDQKEFEEWMTARWA
FT                   EKDQLMDQYFETGRFPTELAGSIKADHAVDGQQAAALAGYVESYGSLHHWSELGLIFVV
FT                   LVSVAVLCKFVTSWMQ"
     MEPTEVRQRK PPTTKDAGEL QKLSTKPPSE PRLKHGIPMQ ILRSLLLITW ADCCIMAICV        60
     TQLIGCPLYL INRYYYYSYM AYTKQCFGLV LGSVTQWSSP TLFRVSGDAS VRGQIHLSKD       120
     GLLETRFPER LVMISNHQVY TDWVYLWWVA YTNQMHGRIF IILKESLKYI PIVGTGMMFY       180
     GFIFMARKWM SDKPRLQHRL DKLKTAYTGS NSARPQYDPM WLLIFPEGTN LSINTKRRSD       240
     IWGEKQGLPS FKHVILPRST GLFFCLQQLR GTVDWVYDCT MAYEGPPKGS YPDKYFTLRS       300
     TYLQGRPPTS VNMHWRRFQV SKIPLDDQKE FEEWMTARWA EKDQLMDQYF ETGRFPTELA       360
     GSIKADHAVD GQQAAALAGY VESYGSLHHW SELGLIFVVL VSVAVLCKFV TSWMQ            415
//

If you have problems or comments...

PBIL Back to PBIL home page