(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE98

PENCW_16.PE98        Location/Qualifiers
FT   CDS             join(218842..218968,219037..219151,219209..220259)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946713"
FT                   /orf_name="Pc20g00980"
FT                   /product="Pc20g00980 protein"
FT                   /function="NAD+ kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85427.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI0001831D53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR2"
FT                   /transl_table=1
FT                   /translation="MLRAILRRSPRLALRQHFSTSRPRHEIKDIGSLSQRLIPKYQESC
FT                   DGELLCLQWPAPPRNIFLVRKDCAPAVTDSLIEFVNHVSSAYPSIAVILESKTAAEVHS
FT                   SLSFPVYSVSLDEKTTALHDKVDLTVTLGGDGTILHAASVFATCSNVPPVLSFSMGTLG
FT                   FLSEWKFSEFKRAFREVYMSGAGAGDRTHVLEGVPGAGLTEQESEMGPTGWSSVRGKSM
FT                   GSTRGARILMRNRLKVGLFAADGTETTPIRTKTDQGQGVYVMNELLIHRGKEPHLAVVD
FT                   VFVGGRFLTEAVADGIIISTPTGSTAYSLSSGGSIVHPLVPSILLTPICARSLSFRPLV
FT                   LPSSTPITLRLSEKNRGRELEVSLDGVHLGQGMAVGMEVRVWNEEMRHGKNEWQGGVPS
FT                   VMRRSVGCEAHEGWVGGLNGLLKFNHPFGEL"
     MLRAILRRSP RLALRQHFST SRPRHEIKDI GSLSQRLIPK YQESCDGELL CLQWPAPPRN        60
     IFLVRKDCAP AVTDSLIEFV NHVSSAYPSI AVILESKTAA EVHSSLSFPV YSVSLDEKTT       120
     ALHDKVDLTV TLGGDGTILH AASVFATCSN VPPVLSFSMG TLGFLSEWKF SEFKRAFREV       180
     YMSGAGAGDR THVLEGVPGA GLTEQESEMG PTGWSSVRGK SMGSTRGARI LMRNRLKVGL       240
     FAADGTETTP IRTKTDQGQG VYVMNELLIH RGKEPHLAVV DVFVGGRFLT EAVADGIIIS       300
     TPTGSTAYSL SSGGSIVHPL VPSILLTPIC ARSLSFRPLV LPSSTPITLR LSEKNRGREL       360
     EVSLDGVHLG QGMAVGMEVR VWNEEMRHGK NEWQGGVPSV MRRSVGCEAH EGWVGGLNGL       420
     LKFNHPFGEL                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page