(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE99

PENCW_16.PE99        Location/Qualifiers
FT   CDS             join(220869..220885,220946..222959,223018..223527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946714"
FT                   /orf_name="Pc20g00990"
FT                   /product="Pc20g00990 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85428.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831D54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR3"
FT                   /transl_table=1
FT                   /translation="MTSYGNNMYSSEQFMNPGPAPRPPTDRPPKLTLPTNNTATSFGQM
FT                   SLDSPSTPAPSTANLSLFPNTSSPSLAMTRSNTGQNGISIIKEGTVRCKEDKFLATWNT
FT                   RYLILREYKLEFLKSDSGKVVITFPLSSVTAVARSEDSKMAFEVTRLANPKDANSKASL
FT                   LARDLPTKTITCEVKSDDEIYEWIDKIYERCPGMGGVSNPTNFSHRVHVGFDPNTGAFV
FT                   GLPPEWEKLLTSSAITKEDYKNNPQAVIEVLEFYSDIKMREQNPQYYAGINSPSNGQPK
FT                   AYGSSVGSSIAPPRPPPPGPMQRLDSSQSKSDGSMRSASSSVGQSDRAADHQQQVERMK
FT                   EMADQERRRVEEERRNKEEQDAYNASIPKSRPNMAQQELGGYGGDEASQNSRYQPSRPA
FT                   PQAPGSAARQQDPRQLTAQRPAPAPPSQSPYGQNAPRAPGAPRTDDRQGSPSSRYPPSD
FT                   PRAPGSASRHQQNGSKGQAGPPPTRLPAPVQAVKPLNIANKQNGNKQNVPDGVRQAEAA
FT                   LTKKADQPRQKEVRMSAMSENEVMERLRSVVSKDNPNESYSKQRKIGQGASGSVYVARV
FT                   KESAPSSVAHELYRTYGPRCQVAIKQMDLRSQPRKELIVNEIIVMKDSQHPNIVNFLDS
FT                   FLQESSNELWVVMEFMEGGALTDVIDNNQVITEGQIATICAETCKGLAHLHNQSIIHRD
FT                   IKSDNVLLDRVGHVKITDFGFCAKLTETKNKRATMVGTPYWMAPEVVKQKEYGPKVDCW
FT                   SLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKSFLSVCLCVNVQ
FT                   SRASADELLAHEFLQTGCSLASLAELLRWKKATG"
     MTSYGNNMYS SEQFMNPGPA PRPPTDRPPK LTLPTNNTAT SFGQMSLDSP STPAPSTANL        60
     SLFPNTSSPS LAMTRSNTGQ NGISIIKEGT VRCKEDKFLA TWNTRYLILR EYKLEFLKSD       120
     SGKVVITFPL SSVTAVARSE DSKMAFEVTR LANPKDANSK ASLLARDLPT KTITCEVKSD       180
     DEIYEWIDKI YERCPGMGGV SNPTNFSHRV HVGFDPNTGA FVGLPPEWEK LLTSSAITKE       240
     DYKNNPQAVI EVLEFYSDIK MREQNPQYYA GINSPSNGQP KAYGSSVGSS IAPPRPPPPG       300
     PMQRLDSSQS KSDGSMRSAS SSVGQSDRAA DHQQQVERMK EMADQERRRV EEERRNKEEQ       360
     DAYNASIPKS RPNMAQQELG GYGGDEASQN SRYQPSRPAP QAPGSAARQQ DPRQLTAQRP       420
     APAPPSQSPY GQNAPRAPGA PRTDDRQGSP SSRYPPSDPR APGSASRHQQ NGSKGQAGPP       480
     PTRLPAPVQA VKPLNIANKQ NGNKQNVPDG VRQAEAALTK KADQPRQKEV RMSAMSENEV       540
     MERLRSVVSK DNPNESYSKQ RKIGQGASGS VYVARVKESA PSSVAHELYR TYGPRCQVAI       600
     KQMDLRSQPR KELIVNEIIV MKDSQHPNIV NFLDSFLQES SNELWVVMEF MEGGALTDVI       660
     DNNQVITEGQ IATICAETCK GLAHLHNQSI IHRDIKSDNV LLDRVGHVKI TDFGFCAKLT       720
     ETKNKRATMV GTPYWMAPEV VKQKEYGPKV DCWSLGIMAI EMIESEPPYL NEEPLKALYL       780
     IATNGTPRLK KPEKLSKELK SFLSVCLCVN VQSRASADEL LAHEFLQTGC SLASLAELLR       840
     WKKATG                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page