(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_24.PE1

PENCW_24.PE1         Location/Qualifiers
FT   CDS             <430..>1044
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670879"
FT                   /orf_name="Pc31g00010"
FT                   /product="Pc31g00010 protein"
FT                   /protein_id="CAP74123.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183308B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX94"
FT                   /transl_table=1
FT                   /translation="PVACYWELIFSTFSRLVGGREELLLLIDGVTVELLQSRVPKISRK
FT                   DLQSLQVELEEGRLFPNFSEEARQDIWARLKEIDYPIPTLKTFFKDRLYLEVAQSVMKR
FT                   LFVQPRREKITIDQGVYGKYDTPVPISMTLRQEWLGSDLLEFWRFSFQYGFEMTDHQRL
FT                   KWPTDADLEDMLDRRSSGSSFPPKQEIRRHFFTLVRARGFQA"
     PVACYWELIF STFSRLVGGR EELLLLIDGV TVELLQSRVP KISRKDLQSL QVELEEGRLF        60
     PNFSEEARQD IWARLKEIDY PIPTLKTFFK DRLYLEVAQS VMKRLFVQPR REKITIDQGV       120
     YGKYDTPVPI SMTLRQEWLG SDLLEFWRFS FQYGFEMTDH QRLKWPTDAD LEDMLDRRSS       180
     GSSFPPKQEI RRHFFTLVRA RGFQA                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page