(data stored in ACNUC14238 zone)

EMBL: S61948

S61948               Location/Qualifiers
FT   CDS             1..2097
FT                   /partial
FT                   /codon_start=1
FT                   /product="smooth muscle myosin heavy chain isoform SM1A"
FT                   /note="SMHC SM1A;  For the protein sequence (NCBI gibbsq
FT                   133094):  Method: conceptual translation supplied by
FT                   author.  This sequence comes from Fig. 2."
FT                   /db_xref="GOA:Q63862"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63862"
FT                   /protein_id="AAB26775.1"
FT                   /translation="KKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTK
FT                   KVIQYLAVVASSHKGKKDSSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI
FT                   NFDVTGYIVGANIETYLLEKSRAIRHARDERTFHIFYYLIAGAKEKMRNDLLLESFNSY
FT                   TFLSNGFVPIPAAQDDEMFQETLEAMSIMGFSEEEQLAILKVVSSVLQLGNIVFKKERN
FT                   TDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQADFAIEALA
FT                   KATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQ
FT                   QLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPK
FT                   ATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLNDN
FT                   VTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQL
FT                   GKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FT                   FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLE
FT                   EERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTASKVIQRNCAAYLKLRNWQWWRLF
FT                   TKVKP"
     KKRHEMPPHI YAIADTAYRS MLQDREDQSI LCTGESGAGK TENTKKVIQY LAVVASSHKG        60
     KKDSSITGEL EKQLLQANPI LEAFGNAKTV KNDNSSRFGK FIRINFDVTG YIVGANIETY       120
     LLEKSRAIRH ARDERTFHIF YYLIAGAKEK MRNDLLLESF NSYTFLSNGF VPIPAAQDDE       180
     MFQETLEAMS IMGFSEEEQL AILKVVSSVL QLGNIVFKKE RNTDQASMPD NTAAQKVCHL       240
     VGINVTDFTR AILTPRIKVG RDVVQKAQTK EQADFAIEAL AKATYERLFR WILSRVNKAL       300
     DKTHRQGASF LGILDIAGFE IFEVNSFEQL CINYTNEKLQ QLFNHTMFIL EQEEYQREGI       360
     EWNFIDFGLD LQPCIELIER PNNPPGVLAL LDEECWFPKA TDKSFVEKLC SEQGNHPKFQ       420
     KPKQLKDKTE FSIIHYAGKV DYNASAWLTK NMDPLNDNVT SLLNASSDKF VADLWKDVDR       480
     IVGLDQMAKM TESSLPSASK TKKGMFRTVG QLYKEQLGKL MTTLRNTTPN FVRCIIPNHE       540
     KRSGKLDAFL VLEQLRCNGV LEGIRICRQG FPNRIVFQEF RQRYEILAAN AIPKGFMDGK       600
     QACILMIKAL ELDPNLYRIG QSKIFFRTGV LAHLEEERDL KITDVIMAFQ AMCRGYLARK       660
     AFTKRQQQLT ASKVIQRNCA AYLKLRNWQW WRLFTKVKP                              699
//

If you have problems or comments...

PBIL Back to PBIL home page