(data stored in ACNUC15465 zone)

EMBL: U19144.PE1

U19144.PE1           Location/Qualifiers
FT   CDS             100..456
FT                   /codon_start=1
FT                   /product="GAGE-3 protein"
FT                   /protein_id="AAA82746.1"
FT                   /translation="MNLSRGKSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEG
FT                   EPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPE
FT                   EVKTPEEGEKQSQC"
     MNLSRGKSTY YWPRPRRYVQ PPEVIGPMRP EQFSDEVEPA TPEEGEPATQ RQDPAAAQEG        60
     EDEGASAGQG PKPEADSQEQ GHPQTGCECE DGPDGQEMDP PNPEEVKTPE EGEKQSQC         118
//

If you have problems or comments...

PBIL Back to PBIL home page