(data stored in ACNUC7421 zone)

EMBL: U74758.THIL

U74758.THIL          Location/Qualifiers
FT   CDS             169..1146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /product="thiamine monphosphate kinase"
FT                   /function="converts thiamine monophosphate + ATP to
FT                   thiamnie pyrophophate + ADP"
FT                   /db_xref="GOA:P55881"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55881"
FT                   /protein_id="AAB37319.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEPWLEAFS
FT                   DSLFALLNYYDMQLIGGDTTRGPLSMTLGIHGYIPAGRALKRSGAKPGDWIYVTGTPGD
FT                   SAAGLAVLQNRLQVSEETDAHYLIQRHLRPTPRILHGQALRDIASAAIDLSDGLISDLG
FT                   HIVKASGCGARVDVDALPKSDAMMRHVDDGQALRWALSGGEDYELCFTVPELNRGALDV
FT                   AIGQLGVPFTCIGQMSADIEGLNFVRDGMPVTFDWKGYDHFATP"
     MACGEFSLIA RYFDRVRSSR LDVETGIGDD CALLNIPEKQ TLAISTDTLV AGNHFLPDID        60
     PADLAYKALA VNLSDLAAMG ADPAWLTLAL TLPEVDEPWL EAFSDSLFAL LNYYDMQLIG       120
     GDTTRGPLSM TLGIHGYIPA GRALKRSGAK PGDWIYVTGT PGDSAAGLAV LQNRLQVSEE       180
     TDAHYLIQRH LRPTPRILHG QALRDIASAA IDLSDGLISD LGHIVKASGC GARVDVDALP       240
     KSDAMMRHVD DGQALRWALS GGEDYELCFT VPELNRGALD VAIGQLGVPF TCIGQMSADI       300
     EGLNFVRDGM PVTFDWKGYD HFATP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page