GENSCAN 1.0	Date run: 19-Mar-108	Time: 07:39:54

Sequence poulet2 : 10686 bp : 43.79% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:


Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    291    619  329  2  2   82   13   167 0.343   3.40
 1.02 Intr +    684    759   76  0  1  113  103   130 0.997  16.52
 1.03 Intr +   1166   1345  180  1  0  136   36   187 0.849  18.36
 1.04 Intr +   1472   1537   66  1  0   65  115    38 0.897   3.30
 1.05 Intr +   2711   2829  119  1  2   68  119    63 0.995   6.66
 1.06 Intr +   3556   3625   70  1  1  113   34    39 0.569   0.18
 1.07 Intr +   3982   4116  135  0  0   90   60   186 0.999  16.76
 1.08 Intr +   4561   4750  190  0  1  111   67   161 0.999  15.46
 1.09 Intr +   6600   6730  131  1  2   66  113   141 0.999  14.81
 1.10 Intr +   6873   7006  134  2  2   89   86   129 0.998  12.24
 1.11 Intr +   7308   7407  100  0  1   88  109   123 0.999  14.51
 1.12 Intr +   8781   8903  123  2  0  115   96     3 0.520   4.58

Click here for a PostScript image of the predicted gene(s)

Predicted peptide sequence(s):


>poulet2|GENSCAN_predicted_peptide_1|551_aa
MRCPPQGAAPPSGAGAAFRRAFEAAPAALPASPPRRQERGSPRVERDSSGRGEEGGKGAA
AAGSRALGQPDDGPRPLPGFAPRAEPGPGAEAEWRLVGRRPPVPEGGTSEADIALIGLAV
MGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVIGAHSLEEMVSKLKKPRRIIL
LVKAGSAVDDFINKLVPLLETGDIIIDGGNSEYRDTTRRCKELLQKGLLFVGSGVSGGEE
GARYGPSLMPGGSKEAWPHIKTIFQSIAAKVGSGEPCCDWVGEEGAGHFVKMVHNGIEYG
DMQLICEAYHLMKDVVGMDHDEMSQVFEEWNNTELDSFLIEITANILKFKDKDGKYLLPK
IRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERVQASKLLNGPKLTQFS
GNKKAFLEDIRKALYASKIISYAQGFMLLRQAAKEFGWTLNYGGIALMWRGGCIIRSVFL
GKIKDAFDRNPELQNLLLDDFFKTAVEKCQDSWRHVISTGVQHGIPMPCFTTALSFYDGY
RHEVLPANLIQ


Explanation

Gn.Ex : gene number, exon number (for reference)
Type  : Init = Initial exon (ATG to 5' splice site)
        Intr = Internal exon (3' splice site to 5' splice site)
        Term = Terminal exon (3' splice site to stop codon)
        Sngl = Single-exon gene (ATG to stop)
        Prom = Promoter (TATA box / initation site)
        PlyA = poly-A signal (consensus: AATAAA)
S     : DNA strand (+ = input strand; - = opposite strand)
Begin : beginning of exon or signal (numbered on input strand)
End   : end point of exon or signal (numbered on input strand)
Len   : length of exon or signal (bp)
Fr    : reading frame (a forward strand codon ending at x has frame x mod 3)
Ph    : net phase of exon (exon length modulo 3)
I/Ac  : initiation signal or 3' splice site score (tenth bit units)
Do/T  : 5' splice site or termination signal score (tenth bit units)
CodRg : coding region score (tenth bit units)
P     : probability of exon (sum over all parses containing exon)
Tscr  : exon score (depends on length, I/Ac, Do/T and CodRg scores)

Comments

The SCORE of a predicted feature (e.g., exon or splice site) is a
log-odds measure of the quality of the feature based on local sequence
properties. For example, a predicted 5' splice site with
score > 100 is strong; 50-100 is moderate; 0-50 is weak; and
below 0 is poor (more than likely not a real donor site).

The PROBABILITY of a predicted exon is the estimated probability under
GENSCAN's model of genomic sequence structure that the exon is correct.
This probability depends in general on global as well as local sequence
properties, e.g., it depends on how well the exon fits with neighboring
exons.  It has been shown that predicted exons with higher probabilities
are more likely to be correct than those with lower probabilities.