genewise wise2_1_22c (July 29 2000 release) This program is freely distributed under a GPL. See source directory Copyright (c) GRL limited: portions of the code are from separate copyright Query protein: , Comp Matrix: blosum62.bla Gap open: 12 Gap extension: 2 Start/End default Target Sequence genomic Strand: forward Start/End (protein) default Gene Paras: human.gf Codon Table: codon.table Subs error: 1e-05 Indel error: 1e-05 Model splice? model Model codon bias? flat Model intron bias? tied Null model syn Algorithm 623 genewise output Score 261.02 bits over entire alignment Scores as bits over a synchronous coding model Warning: The bits scores is not probablistically correct for single seqs See WWW help for more info , 1 MALWMRLLPLLVLLALWGPDPASAFVNQHLCGSHLVEALYLVCGERGFF MALWMRLLPLL LLALWGPDPA+AFVNQHLCGSHLVEALYLVCGERGFF MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFF genomic 1884 agctaccccccgccgctgcgcgggtgaccctgtccgggctcgtggcgtt tctgtgttcttcttctggcaccccttaaatggcattactattggaggtt gcgggccgcgggggccgatcacactgcacgccacggatccagcgaaccc , 50 YTPKTRREAEDLQ GQVELGGGPG YTPKTRREAEDLQ GQVELGGGPG YTPKTRREAEDLQ V:V[gtg] GQVELGGGPG genomic 2031 tacaaccggggccGGTGAGCC Intron 1 CAGTGgcggcgggcg accacggacaata <1-----[2071 : 3216]-1> gatatgggcg cacgccggagcgg gggggcgctt , 74 AGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN AGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN AGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN genomic 3249 ggaccctgcggtccacgaggcttaaattctccgatta cggtactctagctaaggttaaggcgtgctaataaaga accggcgcgggcgggtctgaactcccccccgggcccc //