Package {akin}


Type: Package
Title: Functional Utilities for Data Processing
Version: 0.3.2
Description: Covers several areas of data processing: batch-splitting, reading and writing of large data files, data tiling, one-hot encoding and decoding of data tiles, stratified proportional (random or probabilistic) data sampling, data normalization and thresholding, substring location and commonalities inside strings, and location and tabulation of amino acids, modifications or associated monoisotopic masses inside modified peptides. The extractor utility implements code from 'Matrix.utils', Varrichio C (2020), https://cran.r-project.org/package=Matrix.utils.
License: GPL (≥ 3)
Imports: data.table (≥ 1.18.2.0), RVerbalExpressions (≥ 0.1.0), RcppAlgos(≥ 2.9.3), methods
Depends: R (≥ 4.1.0), callr, fastmatch, future.apply, listenv, Matrix, utils
Encoding: UTF-8
Suggests: future, testthat (≥ 3.0.0)
Config/testthat/edition: 3
Config/roxygen2/version: 8.0.0
NeedsCompilation: no
Packaged: 2026-05-03 18:50:39 UTC; Dragos
Author: Dragos Bandur [aut, cre]
Maintainer: Dragos Bandur <dbandur@sympatico.ca>
Repository: CRAN
Date/Publication: 2026-05-04 04:30:02 UTC

Functional Utilities For Data Processing

Description

The intent of this package is utilitarian which explains the relatively large number of informative messages displayed by most functions. Designed for large and very large data files, the package employs data.table, list environments, sparse matrices, iterators, background and parallel processing in few places. Nevertheless, Users could consider thread optimization or memoisation, as these techniques were outside the scope.

The package covers several areas of data processing: subset reading and writing of large data files, data tiling (horizontal and vertical splitting) - suited for data conversion operations with local as well as global hold, such as one-hot encoding - stratified, proportional, random or probabilistic data sampling, data normalization and thresholding, substring location inside strings e.g. peptides inside protein chains, common substrings identification and location-tabulation of amino acids, modifications or their associated monoisotopic masses inside modified peptides covering various representations of protein mass spectrometry data with no pretense of exhaustiveness.

Comments and suggestions regarding tricky situations are provided however brief. Examples should be run individually in R console. When possible, suppression of messages should be avoided.

Author(s)

Maintainer: Dragos Bandur dbandur@sympatico.ca

Authors:


Deprecated Functions In Package akin

Description

The following functions are deprecated. Where available, alternative functions are suggested at help("common-deprecated").

Checks and identifies substrings that are common in a pair of strings.

Usage

common(
  X,
  Y = NULL,
  from,
  to,
  lower = NULL,
  upper = NULL,
  outlist = FALSE,
  rows = 1000,
  wait = 100,
  ...
)

Arguments

X, Y

character, length = 1 each: a string, such as a protein chain. When Y = NULL, all arguments coming after X should be named

from, to

integer length 1 each. Range of string character lengths to be identified. When to is missing from call, only substrings of length equal to from value are sought

lower, upper

integer, length 1 each, default NULL: spans all substring combinations. Otherwise, spans only a subset of combinations starting with the lower-th and ending with the upper-th combinations. See RcppAlgos::comboGeneral

outlist

logical. Default, FALSE, return a character vector of common substrings. TRUE, return a list of valid substrings found in each chain

rows

integer length 1. Default 1000. The number of rows (combinations) in each combinations matrix

wait

integer length 1. Default 100. Duration of the background process polling. Unit: milliseconds. During this time, the main process is blocked.

...

not used

Details

Using brute combinatorial approach, this utility partitions each chain in the pair into all possible combinations of substrings with lengths inside the from-to window. Each combination is filtered for uniqueness and appartenance to its original chain (i.e. for validity), yielding a fraction of common substrings out of all substrings. Inside the valid set, each substring represents the truncation in a sequence of longer substrings.

The overhead causes severe search time increase with the total number of combinations which, depend on chain and substring lengths, and search window width. Slight performance improvement comes from variations in rows value i.e. by balancing the number of combinations matrix rows with the total number of combinations matrices. The default value is an acceptable starting point. Chains of several hundreds of characters, such as long protein chains, may take hours on some machines. In such cases, rows value can be risen toward the order of 1e6. When Y != NULL, the partitioning of chains runs asynchronously.

The lower and upper limits. Setting any or both of these arguments reduces the search time and only establishes whether any common substrings exist at all, without guaranteeing complete results. In case of very long chains, setting these limits too wide apart may lead to memory allocation error. Checking the number of combinations before run is recommended, see RcppAlgos::comboCount, utils::combn etc.

NOTE: This utility uses background processing. Check "Security Considerations" in callr package documentation.

Value

A character vector of common substrings or a list of valid substrings found in both chains. When Y = NULL, a list of all valid substrings in X within the from-to window.

common

Instead of common, use fcommon

See Also

akin-deprecated, comboIter, comboGeneral, comboCount


Calculate The Number Of Combinations Of String Covering

Description

Calculates the number of subset family (covering) combinations for common substrings identified by function fcommon.

Usage

cover(x, wplot = FALSE)

Arguments

x

integer, length = 1 or character vector, length > 1, or character string

wplot

logical, FALSE. When TRUE, displays a plot of combinations versus number of characters in substring

Details

This function helps in deciding the parameters for parallel tasks of function fcommon. It finds the total, the minimum and the maximum of number of combinations processed by fcommon for individual substring covering.

Since at peak workload each worker receives by default 1e6 combinations for processing (see argument ... in fcommon documentation), the number of workers in a plan is effectively decided taking the maximum number of combinations as reference. The min:max range relates to workers idling outside the peak: setting a plan with too many workers would render many of them idle during fcommon's parallel run. On another hand, setting it with too few, may challenge the default workload limit (see argument maxSize in fcommon documentation).

When x is an integer, it must equal either the nchar(string) or the length(character).

Value

A prettified named vector showing the total, minimum and maximum number of combinations for respective string, along with a plot (wplot = TRUE).

See Also

fcommon

Examples


if (interactive()) {

# 1. x is a character

# 1.1 A string
x = 'tyrvvsvltvlhqdwlngkeykck'

a = cover(x)
print(a)

# 1.2 A vector
x = strsplit(x, '')[[1]]

b = cover(x)
print(b)

# 2 An integer

n = length(x)
c = cover(n, TRUE)
print(c)

}



Fast Identify Common Substrings In A Pair Of Strings

Description

Checks and identifies substrings that are common to a pair of strings.

Usage

fcommon(x, y, strategy = NULL, workers = NULL, maxSize = NULL, ...)

Arguments

x, y

character, length 1 each: a string, such as a protein chain. y can be missing

strategy

character, length 1 or symbol. Strategy for parallel processing. Choices are "multisession", "multicore" and "cluster". Default NULL, which corresponds to sequential processing

workers

integer, length 1. Number of workers in plan. Default, NULL which, when strategy != NULL selects all available logical CPUs (not always recommended). Requires strategy != NULL

maxSize

integer, length 1. Size of object sent to each worker during parallel processing. Default, NULL corresponding to 500.0 MiB according to future.globals.maxSize. Requires strategy != NULL

...

reserved for internal arguments rows, default value 100, representing maximum number of combinations matrix rows sent to the iterator during sequential processing and brows, default value 1e6 representing maximum number of combinations matrix rows sent to each logical CPU during parallel processing. These arguments should always be named

Details

This utility identifies all common substrings in the x, y pair of strings by isolating sequences of identical characters in both strings, which then are packed into substrings and validated. This set of common, shorter than original, strings lowers the combinatorial overhead which, next, searches for elements of the subset family (i.e. the covering) of each common substring. Further filtering validates sub-substrings that are elements of each common substring (truncations or otherwise). Finally, only a fraction of all combinations generate the set of common substrings. All one-character substrings are removed.

Common substrings up to 20 characters length are processed sequentially and longer common substrings are returned, when found, with a message. Longer substrings can be processed in parallel by setting values for strategy and workers which set a local plan, triggering the parallel processing mode. Function cover helps adjusting the plan.

maxSize. By default, the size of objects sent to each logical CPU during parallel processing is set at 500.0 MiB. Parallel processing of strings of more than 30 characters length may challenge this limit if the number of workers set in plan is small in relation to the length of these substrings. To decrease worker's load, a recommended approach is to increase the number of workers or, to lower the number of brows in the ... list (which may result in a longer processing time). Otherwise, check future.globals.maxSize option and set a value for maxSize as suggested there.

Value

A sorted character vector of common substrings longer than 2 characters each. When y is missing from call, a sorted character vector of valid substrings in x longer than 2 characters each.

See Also

cover, plan, future.globals.maxSize, comboIter, comboGeneral, detectCores

Examples


if (interactive()) {

 # Check for common substrings in the pair below

 x = 'dvvmtqsplslpvtpgepasiscrssqslaktyrvvsvltvlhqdwlngkeykckvv'
 y = 'mtqspltyrvvsvltvlhqdwlngkeykcksnkalpapiektisk'

# 1. Sequential Run

# 1.1 Brief output
 system.time(a <- fcommon(x, y))
 print(a)                                              # output and message

# 1.2 Long substring discovered above
z = 'tyrvvsvltvlhqdwlngkeykck'

# 1.3 Check the workload in parallel processing
cover(z, TRUE)                                         # covering combinations
                                                       # and plot
# The "max" value suggests that 3 workers suffice

# 2. Parallel run
## Not run: 
 system.time(b <- fcommon(x, y, multisession, 3))      # the plan is set
 print(b)                                              # extended output

## End(Not run)
}


Find Substring Locations Inside A String

Description

Finds all locations of a known character substring inside a character string.

Usage

findLoc(
  subchain,
  chain,
  outlist = FALSE,
  named = FALSE,
  all. = FALSE,
  which = min,
  ignore.case = TRUE,
  perl = FALSE,
  fixed = FALSE,
  useBytes = FALSE
)

Arguments

subchain

character, length 1, e.g. a peptide sequence

chain

(named) character, length 1 or a (named) list of such characters such as a list of protein chains obtained from a fasta file

outlist

logical. Default, FALSE, the output is a (named) integer vector of locations. Otherwise, it is a (named) list of location vectors, each corresponding to a chain in a list of chains

named

logical. Default, FALSE. Output is not named. Otherwise, the output is named

all.

logical, default FALSE, returns the leftmost or the rightmost location inside the chain. When TRUE, returns all locations inside the chain for each chain in a list

which

symbol. Location to report. Default, min. Requires all. = FALSE. which = min returns the leftmost location inside the chain, e.g. closest to the N-terminus of a protein chain. which = max returns the rightmost location, e.g. closest to the C-terminus of a protein chain. Overwritten when all. = TRUE

ignore.case, perl, fixed, useBytes

arguments to base::gregexpr

Details

Wrapper to base::gregexpr, the function scans all chains in a list of chains to find subchain locations. The location is defined as the position inside the chain relative to the left end of the chain of the first subchain character.

Value

A (named) integer or a (named) list of integer vectors of subchain locations inside the chain.

See Also

gregexpr

Examples


if (interactive()) {

# 1. List of chains

chain = list(chain1 = 'alpdxoipoyloiekladxoipoylyl',
             chain2  = 'kdxoipoylyydxoipoylopldxoipoylac')
subchain = 'DXOIPOYL'                                                  # ignoring the case

findLoc(subchain, chain, outlist = TRUE, named = TRUE, all. = TRUE)    # named list
findLoc(subchain, chain, named = TRUE, all. = TRUE)                    # named integer
findLoc(subchain, chain, outlist = TRUE, named = TRUE)                 # the leftmost positions
findLoc(subchain, chain, which = max, named = TRUE)                    # the rightmost positions

# 2. Single chain

chain = chain[[1]]

findLoc(subchain, chain, all. = TRUE)
findLoc(subchain, chain, which = max)
findLoc(subchain, chain)                                               # default location
findLoc(subchain, chain, which = max, ignore.case = FALSE)             # not ignoring the case

}


Extract Encoded Variables From Encoded Split Or Tiled Data

Description

Extracts a single encoded variable from a list or listenv of encoded matrices containing multiple encoded variables

Usage

getEV(en, name, ...)

Arguments

en

a (named) list, or listenv of matrices or a single matrix, all containing multiple encoded variables. See oneHot decoder for lists and matrices containing single encoded variables

name

character, length 1. Column name as found in source data

...

default, empty. Used to convert the class of extracted matrix to 'dgCMatrix' or 'matrix'

Details

This function includes code from package "Matrix.utils" v 0.9.8, published under GPL-3 license, currently removed from CRAN. With thanks to the package Author!

NOTE 1: If name is a source data column name that appears inside other column names, the extracted matrix will combine all encoded matrices having this name inside their column names. Although the extracted matrix is a proper matrix of encodings, it no longer represents a single encoded data column. As result, upon decoding, the oneHot decoder will report ambiguous decoding.

NOTE 2: a warning reading either "single-column encoded matrix for ..." or "number of columns of result is not a multiple of vector length (arg 2) ..." may appear when extracting an encoded categorical variable from a list of encoded matrices. Most likely, this happens with low cardinality encoded variables. The warning signals that most encoded matrices associated with respective variable contain subsets of only one category (level) when, ideally, most of these matrices should contain a mixture of two or more categories or levels; thus, allowing matrix row-binding by category's label. One or more of the following suggestions will solve the issue: a) shuffle the data before encoding, b) increase the number of rows in data chunks when encoding, c) if memory allows, opt for tileHot encoding single matrix output, as shown in Example 2.1, solution c.

Value

A dense or sparse matrix of single encoded variable which can be decoded with the oneHot decoder.

See Also

oneHot, tileHot

Examples


if (interactive()) {

# 1. mtcars data have all columns type "double"

data(mtcars)
a = lapply(mtcars, oneHot, encode)                       # encode mtcars data
print(a)                                                 # list of sparse matrices
b = getEV(a, 'cyl')                                      # extract encoded "cyl" column
print(b)                                                 # a 32x3 sparse matrix
c = oneHot(b, decode)                                    # revert
identical(mtcars$cyl, c)                                 # FALSE. 'mtcars$cyl' is type "double"
isTRUE(all.equal(mtcars$cyl, c))                         # TRUE

# 2. Warnings associated with low cardinality categorical variable

# See tileHot() Examples for full decoding of a dataset

# 2.1 Make 'csv' file
data(iris)                                               # low cardinality "Species"
tempf = tempfile(fileext = '.csv')
write.table(iris, tempf , sep = ',', row.names = FALSE, quote = FALSE)

A = tileHot(readpath = tempf, rows = 14, splits = 3)     # encoded tiles list
print(A[[11]][[5]])                                      # e.g. one-column matrix
a = getEV(A, 'Species')                                  # warning
colSums(a)                                               # incorrect!

# solution b
B = tileHot(readpath = tempf, rows = 60, splits = 3)     # increase number of rows
b = getEV(B, 'Species')                                  # still warning
colSums(b)                                               # incorrect!

# Solution b) could work in combination with solution a)

# solution c
C = tileHot(tempf, rows = 14, splits = 3, orn = TRUE)    # encoded matrix
c = getEV(C, 'Species')                                  # no warning
colSums(c)                                               # correct!

unlink(tempf)

# 2.2 Shuffled 'csv' file
tempf = tempfile(fileext = '.csv')
iris22 = iris[{ set.seed(327); sample.int(150) },]      # shuffled iris data
write.table(iris22, tempf , sep = ',', row.names = FALSE, quote = FALSE)

A = tileHot(readpath = tempf, rows = 14, splits = 3)    # same as above

#solution a
a = getEV(A, 'Species')                                 # no warning
colSums(a)                                              # correct!

unlink(tempf)

}



Locate And Extract Modifications Or Monoisotopic Masses From A Modified Peptide

Description

Finds and tabulates amino acid modification sites and extracts modifications or monoisotopic masses from modified peptide data representation.

Usage

locateMod(string, wrap = "]", inbracket = ")", except = NULL, rmve = NULL)

Arguments

string

character, length 1. Modified or unmodified peptide, or NULL

wrap

character, length 1. The closing (right-hand) side of any of the bracket types ']', ')', '}' that wrap the modifications, such as in protein mass spectrometry data representation of modified peptides. Default, ']'

inbracket

character, length 1. Same as above for brackets used inside modification wrappings. Default, ')'

except

character, length >= 1. Default, NULL. Punctuation marks or characters that appear along modifications and are needed to remain present in the output: '-', '+', ',', ';', ':', '=', '.', ⁠[:digit:]⁠, ⁠[:alpha:]⁠, '\w+', ' '

rmve

character, length 1. Default, NULL. Regular expression. Digits or extra characters that need to be removed from the output (see Examples)

Details

Although capable of handling most situations, it is recommended that the wrapping bracket type remains consistent throughout and the inbracket type be different from wrapping type. No extra characters are removed from result when except = rmve = NULL.

This utility covers most data representation styles for modified peptide. However, clean data results are not guaranteed. The template for letter casing accepted for modified peptide and for modifications should match those presented in Examples: upper case for peptide and mixed case for modifications.

Value

A 'data.table' class data frame containing the unmodified peptide, the modified peptide, the modification site (i.e. the amino acid code letter and location inside the peptide) and the associated modification(s). In case of monoisotopic mass extraction, monoisotopic mass values populate column "Modification" as "character" types. Multiple modifications (identical or not) found at the same site are listed as many times as they appear at that site. Unmodified, endogenous peptides are listed with no other information. Empty strings are listed as such with a warning.

See Also

regex

Examples


if (interactive()) {

# Completely made-up modified peptides:

# 1. Modifications

# 1.1 Default brackets
string = 'K[Prop_A][Met][Prop (C)]PSSABCELR[Prop][Prop][Prop]FQC[Carba (C)]GQQ[Met +44]TARP'

a = locateMod(string)
print(a)                                                              # with extra-characters
b = locateMod(string, except = '\\w+', rmve = '(\\(.*\\)|_[A-Z]|[0-9])')
print(b)                                                              # without extra-characters

# In this example argument "rmve" contains the default in-brackets

# 1.2 Alternative bracketing

string = 'K{Prop_A}{Met}{Prop [A]}PSSABCELR{Prop +15}{Prop}{Prop}FQC{Carba [C]}GQQ{Met +44}TARP'

c = locateMod(string, '}', ']')
print(c)
d = locateMod(string, '}', ']', except = '\\w+', rmve = '(\\[.*\\]|_[A-Z]|[0-9])')
print(d)

# In this example argument "rmve" contains the alternative in-brackets

# 2. Empty string

empty = locateMod(""); print(empty)

# 3. Monoisotopic masses

string = 'TAAC[+57.021464]PPC[+57.021464]PAPPAPS[+162.052824]VFLTLMISR'
e = locateMod(string)
print(e)                                                             # with extra-characters
f = locateMod(string, rmve = '[[:punct:]]')$Modification
print(f)                                                             # incorrect values
g = locateMod(string, rmve = '\\+')$Modification
print(g)                                                             # correct!
class(g)                                                             # character
}


One-hot Encoder And Decoder Of Variables

Description

Encodes logical, categorical, integer and double type variables.

Usage

oneHot(x, type, omc = "dgCMatrix", verbose = TRUE)

Arguments

x

a (named) vector or list for encoding. Missing data are removed. For decoding, a dense or sparse matrix (preferably, the result of encoding) representing a single source data column

type

symbol. Choices: encode - one-hot encoding, decode - revert to original

omc

character length 1. Output matrix class. Default, 'dgCMatrix', other option, 'matrix'

verbose

logical, default TRUE, display messages

Details

This utility one-hot encodes when type = encode and verifies the encoded result (or any matrix of encodings obtained with getEV extractor) when type = decode. It detects illicit states.

Value

Encoding returns a matrix of length(x) rows and length(unique(x)) columns or a warning. Decoding returns a (named) vector or a warning. List vectors are returned unlisted. Integer(ish) vectors, converted to integer, character vectors - to factor, double or logical vector types remain unchanged.

Examples


if (interactive()) {

# 1. Encode type "double"

x = runif(9)                           # numeric, length 9
names(x) = letters[1:9]                # named
typeof(x)
a = oneHot(x, encode)                  # a sparse matrix of "dgCMatrix" class
b = oneHot(a, decode)                  # a type "double" named numeric, length 9
isTRUE(all.equal(x, b))                # TRUE
typeof(b)
print(x); print(b)

# 2. Type "logical" with missing values

y = c(TRUE, TRUE, NA, FALSE, TRUE, NA) # logical, length 6 with missing values
typeof(y)
a = oneHot(y, encode, 'matrix')
print(a)                               # a dense matrix
b = oneHot(a, decode)                  # revert
all.equal(y, b)                        # missing values in y removed
typeof(b)
print(x); print(b)

# 3. iris data

data(iris)
a = lapply(iris, oneHot, encode)       # encode entire data
b = as.data.frame(
         lapply(a, oneHot, decode)     # revert
     )
identical(iris, b)                     # TRUE. Now, replace iris data with
                                       # mtcars data!

# 4. Illicit states in one-hot encoding

`3.41` = c(1,0,0,1,1,0,0,1)            # encoded type "double"
`0.12` = c(0,1,0,0,0,1,1,0)
 a = cbind(`3.41`, `0.12`)             # form encoded matrix
 print(a)                              # matrix resembling one-hot encoding
 x = oneHot(a, decode)                 # illicit state detected
 print(x)                              # list with 2 different data types

}


Scaling And Thresholding Of Numeric Variables

Description

Implements classical methods for data scaling: range, z-score normalization, location and location-scale normalization, as well as data thesholding through the simplest form of ReLU rectifier. Missing values are removed in all cases.

Usage

score(x, how, filter = NULL, ...)

Arguments

x

numeric vector, length > 1. Variable to be scaled or filtered

how

symbol. Choices are range, stdev or relu

filter

character, length 1. Default NULL. Choices "positive", "negative". Requires how = relu

...

list reserved for User input of paired values, statistic or otherwise. The list uses individual ellipsis arguments therefore, order of values needs be respected at all times e.g. when how = range min value first, max value second. When how = stdev, mean value first, standard deviation second.

Details

Normalization (scaling) can be applied locally on subsets of x when User inputs the values in the ... list. Otherwise, the scaling is global i.e. it is applied to x as a whole. No assumptions regarding the underlying distribution of x are made.

how != relu. When ... is empty, the function uses the sample statistics of x e.g. the mean, range or standard deviation. Otherwise, it uses values inputted by User case in which, location-scale normalization requires how = stdev and the ... list filled as follows: the min(x) or max(x), or any other value first and sd(x) > 0 or any other positive value second. In particular, location normalization works similarly but with the second value = 1. Other location types, e.g. x/max(x), are obtainable.

NOTE: when ... is populated with custom values, all other arguments should be present and named (see Examples).

how = relu. This option acts as numeric thresholding locally as well as globally. It stands for rectified linear unit and involves no statistics. It applies to numeric types that have ordering property (double, integer). On return, all x attributes are dropped. When filter = 'positive', all negative values are set to zero while positive values remain unchanged. Alternatively, when filter = 'negative', all negative values remain unchanged while all other values are set to zero. The "negative" option was added for symmetry.

Value

Numeric. When missing ... and how != relu, scaled values using x own sample statistics. Otherwise, scaling is based on values inputted by User. When how = relu, x >= 0 or x <= 0, depending on filter setting.

References

Ancillary Statistic for location and location-scale distributions

Examples


if (interactive()) {

# 1. ReLU thresholding

x = { set.seed(223); sort(runif(10, -3, 3)) }
y = score(x, relu, 'positive'); y
z = score(x, relu, 'negative'); z

# 1.1 ReLU Plot
olp = par(no.readonly = TRUE)
par(list(mar = c(1,1,1,1), mgp = c(0,0,0), tcl = -0.01, pty = 's'))
plot(x, y, type = 'l', col = 'steelblue', lwd = 2 ,
       xlim = c(min(x), max(x)), ylim = c(min(x), max(x))
     , ylab = expression(ReLU(x)), xaxs = 'i', yaxs = 'i', axes = FALSE, cex.lab = 0.7)
axis(1, pos = 0, cex.axis = 0.6) ; axis(2, pos = 0, cex.axis = 0.6)
points(x, z, type = 'l', col = 'orangered', lwd = 2)
legend('topleft', legend = c('positive', 'negative'),
       col = c('steelblue', 'orangered'), pch = 'l', lwd = 2, cex = 0.6, bty = 'n')
par(olp)

# 2. Location and location-scale

# 2.1 Location (e.g. "x - max(x)")
x = 1:10
M = max(x)
std = 1
a = score(x, stdev, NULL, M, std); a

# 2.2 Location (e.g. "x/max(x)")
m = 0                                                            # the mean
M = max(x)                                                       # or any value
b = score(x, range, NULL, m, M); b

# 2.3 Location-scale (e.g. "(x - max(x))/sd(x)")
M = max(x)                                                       # or any value
std = sd(x)                                                      # or any value > 0
c = score(x, stdev, NULL, M, std); c

# m, M and std above can be replaced with any values decided by User

# 3. Classical normalization

# 3.1 Range
d = score(x, range); d

# 3.2 z-score
e = score(x, stdev); e

# 4. Local vs. global z-score normalization

data(mtcars)
  x = mtcars$wt
  m = mean(x)
std = sd(x)

ll = split(x, f = as.factor(mtcars$cyl))        # partitioned x

# 4.1 Local scaling
aa = lapply(ll, score, stdev, NULL, m, std)     # filled ... list
na = unlist(aa, FALSE, FALSE)

# 4.2 Global scaling
nb = score(x, stdev)

# 4.3 Local as well as global hold
identical(sort(na), sort(nb))                   # TRUE

}


Read Or Write Subsets Of Data Files From Or To Disk

Description

Reads or writes data files from/to disk in disjoint subsets. This is a two-stage function (see Examples).

Usage

splitH(readpath, writepath = NULL)

Arguments

readpath

character length 1. Full path to the source file

writepath

character length 1. Full path to the destination file

Details

Above arguments apply to Stage 1 only. The arguments for Stage 2 function, which is the output of Stage 1, are the following:

rows integer, length 1. Number of rows per subset. When rows = Inf, the data can be either copied as is or moved to a new location

seq logical, default TRUE: read discrete subsets. Otherwise, progressively appended subsets from first to current

dropcols character of length < ncol(data). Columns to drop. Works only when rows is finite. Replaces argument select from data.table::fread

how symbol. Works only when rows = Inf and writepath location is given. Options: how = scp, data file is copied as is to writepath location; how = mv, data file is moved to writepath location

print logical, default TRUE, each subset written to disk is shown in console. Setting print to FALSE could increase writing speed

orn logical, default FALSE. When TRUE, the original data row numbers are shown in each subset

The main purpose of this utility is to bring manageable subsets from very large data into the working environment for further processing when writepath = NULL. When orn = TRUE, each subset receives a new column named "srn" showing source data row numbers. This column is absent from subsets written to disk regardless of orn value. The source data file can be any type of file readable by data.table::fread.

At the first stage:

There is a functional difference between rows = Inf and rows = nrow(data):

Value

At stage 1, displayed information and a function (a closure). At stage 2, a "data.table" class subset of data or a printout of said subset when written on disk.

References

Part of internal code for Stage 1 was inspired by data.table Issue# 7169

See Also

Linux commands scp and mv

Examples


if (interactive()) {

# Make a 'csv' file

data(mtcars)
tmpf = tempfile(fileext = '.csv')
write.table(mtcars,tmpf , sep = ',', row.names = FALSE, quote = FALSE)

# 1. Read data file step by step

# 1.1 Get information on data
r = splitH(readpath = tmpf)                             # stage 1
class(r)                                                # function

# 1.2 Read data iteratively                             # stage 2
a = r(rows = 11, dropcols = c('am', 'vs'))              # iter1 no original row numbers
b = r(rows = 11, dropcols = c('am', 'vs'), orn = TRUE)  # iter2 w. original row numbers
c = r(rows = 11, dropcols = c('am', 'vs'))              # iter3 the last subset
## Not run: 
d = r(rows = 11, dropcols = c('am', 'vs'))              # iter4 stop! Return to stage 1

## End(Not run)
print(list(a, b, c))

# 2. Read data file completely

r = splitH(readpath = tmpf)                             # stage 1
n = ceiling(32/13)                                      # read 13 rows at a time
a = replicate(n, r(rows = 13), simplify = FALSE)        # read file
class(a)                                                # list
print(a)                                                # a list of tables

tmpf1 = tempfile(fileext = '.csv')                      # new location

# 3. Iteratively write to new location

r = splitH(readpath = tmpf, writepath = tmpf1)          # stage 1
n = ceiling(32/11)                                      # 11 rows each time
invisible(
 replicate(n, r(rows = 11) , simplify = FALSE)          # write to new location
 )
a = data.table::fread(tmpf1)                            # check result
dim(a)
print(head(a))

unlink(tmpf1)

tmpf2 = tempfile(fileext = '.csv')                      # new location

# 4. Move file from tmpf to another location

r = splitH(readpath = tmpf, writepath = tmpf2)          # stage 1
r(rows = Inf, how = mv, print = FALSE)                  # move to new location
a = data.table::fread(tmpf2)                            # check result
print(head(a))

unlink(tmpf)
unlink(tmpf2)

}


Split Data Vertically Into Subsets

Description

Splits data into unequal and disjoint groups of columns (i.e. vertical splits)

Usage

splitV(data, splits)

Arguments

data

a "data.table" class data frame or convertible to "data.table" class

splits

integer, length 1, of value <= ncol(data). The number of disjoint selections (i.e. vertical splits). When splits = 0, there are no splits

Details

The smaller the splits value, the wider the column groups. Column order from source data is not preserved

Value

An exhaustive listenv of disjoint column groups from original data

Examples


if (interactive()) {

# 1. Split iris data vertically

data(iris)
a = splitV(iris, splits = 3)     # split data in 3 column groups
class(a)                         # listenv, environment
print(as.list(a))                # list

}

Extract A Proportional Stratified Sample From A Data Set

Description

Obtains a proportional stratified sample from any data convertible to "data.table" class containing categorical variables.

Usage

stratify(
  X,
  target,
  stratum = NULL,
  size,
  thresh,
  seed = NULL,
  indx = TRUE,
  dis = NULL,
  args = list(),
  ext = FALSE,
  replace = FALSE,
  verbose = TRUE
)

Arguments

X

any data array convertible to "data.table" class

target

character length 1. The name of column considered to be the root stratum. For example, the name of the 'target' categorical column in a classification training set. This argument should always have a value

stratum

character of length <= ncol(data) - 1. Default, NULL. Names of additional categorical data columns which deepen the stratification

size

integer length 1. Default, none. Value set by User. In this case, it is upper-bounded by the size of the thinnest stratum having more than one row. Setting size value above this bound requires sampling with replacement

thresh

integer, length 1. Default, none. An automatic switch between sample size calculation formulae. Can be set when size is missing from call. It can take as value any of the stratum thicknesses shown in the output message

NOTE: it is recommended that both size and thresh values are missing from call until information on stratification becomes available after first run

seed

integer length 1. Seed value for output reproducibility

indx

logical. Default TRUE, returns the sample row index only. FALSE, returns the sampled data

dis

symbol. Default NULL. One of the density or function distributions used for generating probability vectors for probabilistic sampling

args

list of arguments required by distributions as described in stats::distributions documentation. Default, none. NB The list should never include the first argument (x or n) required in documentation, as it is collected internally from each stratum

NOTE: Even if seed is set, the sample row index changes if either the distribution in dis or the values in args is changed

ext

logical, default FALSE. When TRUE, expands the output sampled data with the following extra columns: row - sample rows, strat - stratum, n - stratum total rows (i.e. thickness) and size - the sample size extracted from each stratum. Requires indx = FALSE

replace

logical, default FALSE. When TRUE, sampling with replacement if size is present in call and exceeds the thinnest stratum with more than one row

verbose

logical, default TRUE, display messages

Details

This utility is designed to find a true sample representation of the data under current stratification by matching closely the proportionality of strata as long as argument size is missing from call. Each distinct combination of target and stratum levels defines a stratum. For minimal stratification, argument target must always have a value present in call. All one-row strata, when formed, are simply appended to the compounded output.

size. As column in the extended output, it represents the size of the sample extracted from each stratum, internally derived to be proportional to stratum thickness, unbounded by the thinnest stratum with more than one row. Deep stratification along with high cardinality and imbalance may severely restrict the size of the compounded output which is the sum of all stratum sizes plus the number of one-row strata. The sampling occurs at stratum level except for one-row strata for which size = 0 is interpreted as "no sampling".

As function argument, size is interpreted as the largest sample size without replacement that can be requested, being bounded by the thinnest stratum with more than one row. The presence of size in call alters the proportionality since each stratum - except one-row strata - contributes equally to the output size which is the number of strata times the size value plus the number of one-row strata.

thresh. Automatic switch that modifies stratum sample size calculation method based on the extreme stratum thickness values, stratification depth and total data rows. Internally, it searches for the formula that finds at least one sample size accommodating the thinnest stratum with more than one row. Messages are displayed at runtime although, in most cases the condition is satisfyed at first iteration. When thresh >= nrow(data), each stratum is sampled proportional with the ratio between thinnest and thickest strata, which may lead to a relatively small size output. All other thresh values compromise slightly between output size and proportionality (see Example 3).

Probabilistic Sampling

dis. The prob argument in base::sample cannot be used as required since the length of probability vector varies with stratum thickness. Herein, stratum probability vectors are determined by the distribution specified in argument dis which associates each stratum with a probability vector of thickness length. When args is missing from call, dis uses the default argument values for respective distribution. An error is thrown when the probability vector has insufficient number of non-zero values. See package stats, "Distributions" documentation.

NOTE: The random variate generators i.e. the r* version of distributions, generate vectors of absolute random deviate values which play the role of pseudo-probabilities conformant with the requirements listed in base::sample documentation.

Value

A proportional or non-proportional stratified sample (depending on whether size is absent or present in call), either as row index or as sampled data, compounded from random or probability samples taken from each stratum. Informative messages are displayed. Existing data row names are preserved in the output case in which, the sampled data output gains the column named "rn".

See Also

sample, distributions

Examples


if (interactive()) {

# 1. Row index for sampling

data(mtcars)
rowID = stratify(mtcars
               , target = 'cyl'
               , stratum = c('vs', 'am')
               , seed = 314)                                  # display information
print(rowID)                                                  # integer

# 2. Sampled data with extra-columns

smp = stratify(mtcars
            , 'cyl'
            , c('vs', 'am')
            , seed = 314
            , indx = FALSE
            , ext = TRUE)                                     # extra columns
print(smp)
identical(rowID, smp$row)                                     # TRUE

# 3. Impact of "thresh" value on output size

sl = list()
thresholds = c(2, 4, 12, 32)                                  # stratum thicknesses

for (t in seq(along=thresholds)) {
                  sl[[t]] = stratify(mtcars
                                  , 'cyl'
                                  , c('am', 'vs')
                                  , thresh = thresholds[t]
                                  , seed = 314
                                  , indx = FALSE, ext = TRUE)
                }
names(sl) = quote(thresholds)
print(sl)                                                     # stratified samples
                                                              # of various sizes

# 4. Probabilistic sampling

rowIDn = stratify(mtcars
             , 'cyl'
             , c('vs', 'am')
             , seed = 314
             , dis = pnorm                                    # Normal distribution
             , args = c(mean = 1, sd = 3))                    # no first argument!
rowIDb = stratify(mtcars
             , 'cyl'
             , c('vs', 'am')
             , seed = 314                                     # same seed
             , dis = pbeta                                    # Beta distribution
             , args = c(shape1 = 1, shape2 = 3))              # no first argument!

# Same seed but changing the distribution changes the sample row index
identical(rowIDn, rowIDb)                                     # FALSE

}


Tile And Write Tiled Data To Disk

Description

Splits long and wide data files in lists of disjoint tiles for further processing.

Usage

tileData(readpath, writepath = NULL, rows, splits, ...)

Arguments

readpath

character length 1. Full path to the source file

writepath

character length 1. Full path to the destination file

rows

integer length 1. Number of rows in each subset. Internally, it determines the total number of subsets before the vertical split

splits

integer, length 1. Number of vertical data splits in each above subset. See splitV

...

extra arguments to splitH e.g. dropcols for columns dropped from source data

Details

Facilitates local operations on small size tiles by partitioning the data horizontally and vertically. The list of tiles can be written to disk as "rds" file when a writepath destination is given. The written data can then be read entirely or in subsets (see Example 2).

NOTE: This utility uses background processing. Check "Security Considerations" in callr package documentation.

Value

A listenv of "data.table" class tiles. When writepath is given, it produces a "rds" file containing data tiles.

See Also

splitH, splitV, tileHot, readRDS

Examples


if (interactive()) {

# Make a 'csv' file

data(iris)
tmpf = tempfile(fileext = '.csv')
write.table(iris, tmpf , sep = ',', row.names = FALSE, quote = FALSE)

# 1. Tile data

a = tileData(tmpf, rows = 10, splits = 3)     # 10x2 and 10x1 tiles
class(a)                                      # listenv, environment
str(a)                                        # nested list

tmpf1 = tempfile(fileext = '.rds')            # new location

# 2. Write tiled data

tileData(tmpf, tmpf1, rows = 10, splits = 3)
a = readRDS(tmpf1)[[1]]                  # partial read from new location
print(a)                                     # list component

unlink(tmpf)
unlink(tmpf1)
}



One-hot Encoder Of Tiled Data

Description

One-hot encodes tiled data.

Usage

tileHot(readpath, rows, splits, omc = "dgCMatrix", ...)

Arguments

readpath

character, length 1. Path to source data that is readable with data.table::fread

rows

integer length 1. Number of rows in each data subset. Internally, it determines the total number of subsets before the vertical split

splits

integer, length 1. Number of vertical data splits in each subset, see splitV. Recommended for very wide data frames. When splits = 0, no vertical splitting occurs

omc

character length 1. Output matrix class. Default, "dgCMatrix". Other option: "matrix"

...

reserved for splitH function arguments, such as dropcols or orn = TRUE which is needed for single matrix output

Details

This utility reads the data in disjoint subsets, tiles them and then one-hot encodes each tile. Encoded tiles are returned as nested list of matrices, as a single matrix, as data frame or as a two-component data frame and sparse matrix list, decided through combinations of dropcols, omc and orn values.

NOTE 1: traceability is assured by assembling the data as character names and values from columns marked for encoding. As side effect, at run time the encoding is reported as being applied to "integer(ish)" values only with no loss in accuracy. Empty source data columns gain the "NA" suffix and become single-column, single-valued matrices.

NOTE 2: this utility implements background, processing. Check "Security Considerations" in callr package documentation.

Value

NOTE 3: In this case, row and column binding operations were avoided to prevent situations described in NOTE 2, getEV documentation. As result, the output matrix is gradually populated instead of being gradually expanded.

While orn = TRUE and dropcols != NULL:

NOTE 4: In all above cases, specific encoded variables can be obtained with getEV extractor. When orn = TRUE, oneHot decoded variables extracted from matrix outputs return named vectors having row numbers as names.

See Also

splitH, splitV, oneHot, listenv, Matrix

Examples


if (interactive()) {

# 1. Shuffled data

tempf = tempfile(fileext = '.csv')
data(iris)
iris22 = iris[{ set.seed(327); sample.int(150) },]          # shuffled iris data
rownames(iris22) <- NULL                                    # remove shuffled row names
write.table(iris22, tempf, sep = ',', row.names = FALSE, quote = FALSE)

# 1.1 Output as List
# In most cases, list output requires shuffled data!

A = tileHot(readpath = tempf
          , rows = 14, splits = 3, print = FALSE)           # encoded data tiles
print(A)                                                    # a listenv
print(A[[1]])                                               # a snapshot

# 1.2 Retrieve iris22 data from encoded list output
X = sapply(names(iris22), \(n) getEV(A, n))                 # extract all encoded columns
Y = lapply(
         lapply(X, oneHot, decode)
                               , unname)                    # decoded columns are named vectors!
d = as.data.frame(Y)
identical(iris22, d)                                        # TRUE

unlink(tempf)

# 2. Unshuffled data

# Make unshuffled data 'csv' file
tempf = tempfile(fileext = '.csv')
write.table(iris, tempf, sep = ',', row.names = FALSE, quote = FALSE)

# 2.1 Output as list
# List output fails low cardinality variables on unshuffled data.

E = tileHot(readpath = tempf
              , rows = 14, splits = 3, print = FALSE)      # same as above

# 2.2 Retrieve iris data from encoded list output
V = sapply(names(iris), \(n) getEV(E, n))                  # warning
W = lapply(
         lapply(V, oneHot, decode)
                               , unname)                   # decoded columns are named vectors!
dd = as.data.frame(W)
identical(iris, dd)                                        # FALSE
all.equal(iris, dd)                                        # low cardinality "Species"

# 2.3 Output as matrix
# Matrix output handles low cardinality variables. No data shuffling required.

m = tileHot(readpath = tempf                               # low cardinality "Species"
          , rows = 14
          , splits = 3
          , orn = TRUE,                                    # needed for matrix output
          , print = FALSE)
print(m)                                                   # 150x126 sparse matrix

# 2.4 Retrieve iris data from encoded matrix output
P = sapply(names(iris), \(n) getEV(m, n))                  # extract encoded columns
Q = lapply(
           lapply(P, oneHot, decode)
                              , unname)                    # decoded columns are named vectors!
R = as.data.frame(Q)
identical(iris, R)                                         # TRUE

# 2.5 Output as "data.table" class
D = tileHot(readpath = tempf
          , rows = 14
          , splits = 3
          , omc = 'matrix'                                 # encoded dense matrix
          , dropcols = c('Petal.Width', 'Petal.Length')    # unencoded columns
          , orn = TRUE                                     # needed for matrix output
          , print = FALSE)
print(head(D, 10))                                         # a "data.table" class
dim(D)                                                     # 150x63

# 2.6 Output as a 2-component list
Dl = tileHot(readpath = tempf
          , rows = 14
          , splits = 3
          , omc = 'dgCMatrix'                              # the default class
          , dropcols = c('Petal.Width', 'Petal.Length')    # unencoded columns
          , orn = TRUE                                     # needed for matrix output
          , print = FALSE)
print(Dl)                                                  # 2-component listenv
print(Dl[[1]])                                             # unencoded columns
print(Dl[[2]])                                             # encoded sparse matrix

# iris data can be retrieved from the Dl list in similar fashion described above

unlink(tempf)

}