(data stored in ACNUC941 zone)

EMBL: AF134851

ID   AF134851; SV 1; linear; mRNA; STD; VRT; 1542 BP.
XX
AC   AF134851;
XX
DT   14-SEP-1999 (Rel. 61, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio muscle creatine kinase (mck) mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1542
RX   DOI; 10.1002/(SICI)1520-6408(1999)25:2<158::AID-DVG10>3.3.CO;2-Y.
RX   PUBMED; 10440850.
RA   Ju B., Xu Y., He J., Liao J., Yan T., Hew C.L., Lam T.J., Gong Z.;
RT   "Faithful expression of green fluorescent protein (GFP) in transgenic
RT   zebrafish embryos under control of zebrafish gene promoters";
RL   Dev. Genet. 25(2):158-167(1999).
XX
RN   [2]
RP   1-1542
RA   Liao J., Gong Z.;
RT   ;
RL   Submitted (15-MAR-1999) to the INSDC.
RL   Biological Sciences, National University of Singapore 119260, Singapore
XX
DR   MD5; 922a11188022e73bdaa0289b49ad4ef0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1542
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        39..1184
FT                   /codon_start=1
FT                   /gene="mck"
FT                   /product="muscle creatine kinase"
FT                   /db_xref="GOA:Q9PV91"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022413"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR036802"
FT                   /db_xref="UniProtKB/TrEMBL:Q9PV91"
FT                   /db_xref="ZFIN:ZDB-GENE-980526-109"
FT                   /protein_id="AAD54775.1"
FT                   /translation="MPFGNTHNNFKLNYSVDEEYPDLSKHNNHMAKVLTKEMYGKLRDK
FT                   QTPPGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYDVFKDLFDPVISDRHGGYKATD
FT                   KHKTDLNFENLKGGDDLDPNYFLSSRVRTGRSIKGYPLPPHNSRGERRAVEKLSVEALS
FT                   SLDGEFKGKYYPLKSMTDDEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNEN
FT                   KAFLVWVKQEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVL
FT                   TCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNAD
FT                   RIGSSEVEQVQCVVDGVKLMVEMEKKLGEGQSIDSMIPAQK"
XX
SQ   Sequence 1542 BP; 398 A; 384 C; 385 G; 373 T; 2 other;
     cttttgttgt cttttgtgca gtgttagaaa ccgcaatcat gcctttcgga aacacccaca        60
     acaacttcaa gctgaactac tcagttgatg aggagtatcc agaccttagc aagcacaaca       120
     accacatggc caaggtgctg actaaggaaa tgtatggcaa gcttagggac aagcagaccc       180
     cacctggatt cactgtggat gatgtcatcc agactggtgt tgacaatcca ggccacccct       240
     tcatcatgac cgtcggctgt gttgctggtg atgaggagtc ctacgatgtt ttcaaggacc       300
     tgttcgaccc cgtcatttcc gaccgtcacg gtggatacaa ggcaactgac aagcacaaga       360
     ccgacctcaa ctttgagaac ctgaagggtg gtgatgacct ggaccccaac tacttcctga       420
     gcagccgtgt gcgtaccgga cgcagcatca agggataccc cctgcccccc cacaacagcc       480
     gtggagagcg cagagctgtg gagaagctgt ctgttgaagc tctgagtagc ttggatggag       540
     agttcaaggg caagtactac cccctgaagt ccatgactga tgacgagcag gagcagctga       600
     tcgctgacca cttcctcttt gacaaacccg tctcccccct gctgctggct gctggtatgg       660
     cccgtgactg gcccgatgcc agaggcattt ggcacaatga gaacaaagcc ttcctggtct       720
     gggtgaaaca ggaggatcac ctgcgtgtca tttccatgca gaagggtggc aacatgaagg       780
     aagtgttcaa gcgcttctgc gttggtcttc agaggattga ggaaattttc aagaagcaca       840
     accatgggtt catgtggaac gagcatcttg gtttcgtcct gacctgcccc tccaacctgg       900
     gcacaggcct gcgcggtgga gtccacgtca agctgcccaa gctcagcaca catgccaagt       960
     ttgaggagat cctgaccaga ctgcgcctgc agaagcgtgg cacagggggt gtggacaccg      1020
     cttccgttgg tggagtgttt gacatttcca acgctgaccg tatcggctct tcagaggttg      1080
     agcaggtgca gtgtgtggtt gatggtgtca agctgatggt ggagatggag aagaagctgg      1140
     gagaaggcca gtccatcgac agcatgatcc ctgcccagaa gtaaagcggg aggcccttcc      1200
     atttttttct tcgtctttgt ctgttttttt acagtccaac agcaacgsag aggaaaactg      1260
     ctgctcaaaa agacagtctc acctttgcac ctgtcttctt tccttttttt cccttcttct      1320
     ctaatttcca tgtcatttcg ccatcttttt ttccactttg tttcctatta agtcggtaac      1380
     atcttgggat cagatacccg gsgcaggagt gagtgcttgt tgctgaggct tcacctcaat      1440
     ttcagccttg gttgtaaaaa gtgaatcaat caaagttgta tttcaaaata aaaatcccca      1500
     ataaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page