(data stored in ACNUC941 zone)

EMBL: AY036972

ID   AY036972; SV 1; linear; mRNA; STD; VRT; 1552 BP.
XX
AC   AY036972;
XX
DT   05-SEP-2001 (Rel. 69, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Danio rerio muscle-specific creatine kinase mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1552
RX   DOI; 10.1139/bcb-79-6-779.
RX   PUBMED; 11800019.
RA   Harder G., McGowan R.;
RT   "Isolation and characterization of the muscle-specific isoform of creatine
RT   kinase from the zebrafish, Danio rerio";
RL   Biochem. Cell Biol. 79(6):779-782(2001).
XX
RN   [2]
RP   1-1552
RA   Harder G., McGowan R.;
RT   ;
RL   Submitted (29-MAY-2001) to the INSDC.
RL   Zoology, University of Manitoba, Ft. Garry Campus, Winnipeg, MB R3T 2N2,
RL   Canada
XX
DR   MD5; 8fa9612940388930d72cf5c9a85d416a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1552
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        67..1212
FT                   /codon_start=1
FT                   /product="muscle-specific creatine kinase"
FT                   /db_xref="GOA:Q90X19"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022413"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR036802"
FT                   /db_xref="UniProtKB/TrEMBL:Q90X19"
FT                   /db_xref="ZFIN:ZDB-GENE-980526-109"
FT                   /protein_id="AAK64515.1"
FT                   /translation="MPFGNTHNNFKLNYSVDEEYPDLSKHNNHMAKVLTKEMYGKLRDK
FT                   QTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATD
FT                   KHKTDLNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALS
FT                   SLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNEN
FT                   KTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVL
FT                   TCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNAD
FT                   RIGSSEVEQVQCVVDGVKLMVEMEKKLEKGESIDSMIPAQK"
XX
SQ   Sequence 1552 BP; 391 A; 393 C; 393 G; 375 T; 0 other;
     acaggatctg atcccaagga ctgttaccac ttttgttgtc ttttgtgcag tgttagaaac        60
     gcaatcatgc ctttcggaaa cacccacaac aacttcaagc tgaactactc agttgatgag       120
     gagtatccag accttagcaa gcacaacaac cacatggcca aggtgctgac taaggaaatg       180
     tatggcaagc ttagggacaa gcagaccccc actggattca ctgtggatga tgtcatccag       240
     accggtgttg acaatccagg ccaccccttc atcatgaccg tcggctgtgt tgctggtgat       300
     gaggagtcct acgaagtgtt caaggatctg ttcgaccccg tcatttccga ccgtcacggt       360
     ggatacaagg caactgacaa gcacaagacc gacctcaact ttgagaacct gaagggtggt       420
     gatgacctgg acccaaacta tgtcctgagc agccgtgtgc gtaccggacg cagcatcaag       480
     ggatacgccc tgccccccca caacagccgt ggagagcgca gagctgtgga gaagctgtct       540
     gttgaagctc tgagcagctt ggatggagag ttcaagggca agtactaccc cctgaagtcc       600
     atgactgatg ccgagcagga gcagctgatc gctgaccact tcctctttga caaacccgtc       660
     tcccccctgc tgctggctgc tggtatggcc cgtgactggc ccgatgccag aggcatttgg       720
     cacaatgaga acaagacctt cctggtctgg gtgaacgagg aggatcacct gcgtgtcatt       780
     tccatgcaga agggtggcaa catgaaggaa gtgttcaagc gattctgcgt tggtcttcag       840
     aggattgagg aaattttcaa gaagcacaac catgggttca tgtggaacga gcatcttggt       900
     ttcgtcctga cctgcccctc caacctgggc acaggcctgc gcggtggagt ccacgtcaag       960
     ctgcccaagc tcagcacaca tgccaagttt gaggagatcc tgaccagact gcgcctgcag      1020
     aagcgtggca caggtggtgt ggacaccgcc tccgttggtg gagtgtttga catttccaac      1080
     gctgaccgta tcggctcttc agaggttgag caggtgcagt gtgtggttga tggtgtcaag      1140
     ctgatggtag agatggagaa gaagctggag aagggcgagt ccatcgacag catgatccct      1200
     gcccagaagt aaagcgggag ctcttccatt tttttctcgt ctttgtctgt ttttttacag      1260
     tccaacagca acgcagagga aaactgctgc tcaaaaagac agtctcacct ttgcacctgt      1320
     cttctttcct ttttttccct tcttctctaa tttccatgtc atttcgccat ctttttttcc      1380
     actttgtttc ctattaagtc ggtaacatct tgggatcaga tacccggcgc aggagtgagt      1440
     gcctgttgct gaggcttcac ctcaatttca gccttggttg taaaaagtga atcaatcaaa      1500
     gttgtatttc aataaaaata cccccataaa acaaaaaaaa aaaaaaaaaa aa              1552
//

If you have problems or comments...

PBIL Back to PBIL home page