(data stored in ACNUC941 zone)

EMBL: BC056706

ID   BC056706; SV 1; linear; mRNA; STD; VRT; 1583 BP.
XX
AC   BC056706;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Danio rerio creatine kinase, muscle a, mRNA (cDNA clone MGC:65905
DE   IMAGE:6801732), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1583
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1583
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a46b92cb49393d6de38ece9212076cbb.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Chi-Bin Chien
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 121 Row: p Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 18858426.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1583
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZEmb3"
FT                   /clone="MGC:65905 IMAGE:6801732"
FT                   /tissue_type="Embryo, zebrafish whole embryo 72 hpf"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            1..1583
FT                   /gene="ckma"
FT                   /note="synonyms: CK-M, cb51, wu:fa28d05, ckm"
FT   CDS_pept        85..1230
FT                   /codon_start=1
FT                   /gene="ckma"
FT                   /product="creatine kinase, muscle a"
FT                   /db_xref="GOA:Q90X19"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022413"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR036802"
FT                   /db_xref="UniProtKB/TrEMBL:Q90X19"
FT                   /db_xref="ZFIN:ZDB-GENE-980526-109"
FT                   /protein_id="AAH56706.1"
FT                   /translation="MPFGNTHNNFKLNYSVDEEYPDLSKHNNHMAKVLTKEMYGKLRDK
FT                   QTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATD
FT                   KHKTDLNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALS
FT                   SLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNEN
FT                   KTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVL
FT                   TCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNAD
FT                   RIGSSEVEQVQCVVDGVKLMVEMEKKLEKGESIDSMIPAQK"
XX
SQ   Sequence 1583 BP; 403 A; 397 C; 399 G; 384 T; 0 other;
     cctatttcgg cttggtgaac aggatctgat cccaaggact gttaccactt ttgttgtctt        60
     ttgtgcagtg ttagaaacgc aatcatgcct ttcggaaaca cccacaacaa cttcaagctg       120
     aactactcag ttgatgagga gtatccagac cttagcaagc acaacaacca catggccaag       180
     gtgctgacta aggaaatgta tggcaagctt agggacaagc agacccccac tggattcact       240
     gtggatgatg tcatccagac cggtgttgac aatccaggcc accccttcat catgaccgtc       300
     ggctgtgttg ctggtgatga ggagtcctac gaagtgttca aggatctgtt cgaccccgtc       360
     atttccgacc gtcacggtgg atacaaggca actgacaagc acaagaccga cctcaacttt       420
     gagaacctga agggtggtga tgacctggac ccaaactatg tcctgagcag ccgtgtgcgt       480
     accggacgca gcatcaaggg atacgccctg cccccccaca acagccgtgg agagcgcaga       540
     gctgtggaga agctgtctgt tgaagctctg agcagcttgg atggagagtt caagggcaag       600
     tactaccccc tgaagtccat gactgatgcc gagcaggagc agctgatcgc tgaccacttc       660
     ctctttgaca aacccgtctc ccccctgctg ctggctgctg gtatggcccg tgactggccc       720
     gatgccagag gcatttggca caatgagaac aagaccttcc tggtctgggt gaacgaggag       780
     gatcacctgc gtgtcatttc catgcagaag ggtggcaaca tgaaggaagt gttcaagcgc       840
     ttctgcgttg gtcttcagag gattgaggaa attttcaaga agcacaacca tgggttcatg       900
     tggaacgagc atcttggttt cgtcctgacc tgcccctcca acctgggcac aggcctgcgc       960
     ggtggagtcc acgtcaagct gcccaagctc agcacacatg ccaagtttga ggagatcctg      1020
     accagactgc gcctgcagaa gcgtggcaca ggtggtgtgg acaccgcctc cgttggtgga      1080
     gtgtttgaca tttccaacgc tgaccgtatc ggctcttcag aggttgagca ggtgcagtgt      1140
     gtggttgatg gtgtcaagct gatggtggag atggagaaga agctggagaa gggcgagtcc      1200
     atcgacagca tgatccctgc ccagaagtaa agcgggagct cttccatttt tttctcgtct      1260
     ttgtctgttt ttttacagtc caacagcaat gcagaggaaa actgctgctc aaaaagacag      1320
     tctcaccttt gcacctgtct tctttccttt tttttccctt cttctctaat ttccatgtca      1380
     tttcgccatc tttttttcca ctttgtttcc tattaagtcg gtaacatctt gggatcagat      1440
     acccggcgca ggagtgagtg cctgttgctg aggcttcacc tcaatttcag ccttggttgt      1500
     aaaaagtgaa tcaatcaaag ttgtatttca ataaaaatac cccataaacc aaaaaaaaaa      1560
     aaaaaaaaaa aaaaaaaaaa aaa                                              1583
//

If you have problems or comments...

PBIL Back to PBIL home page