(data stored in ACNUC941 zone)

EMBL: BC065844

ID   BC065844; SV 1; linear; mRNA; STD; VRT; 1576 BP.
XX
AC   BC065844;
XX
DT   28-JAN-2004 (Rel. 78, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Danio rerio creatine kinase, muscle a, mRNA (cDNA clone MGC:77658
DE   IMAGE:6997100), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1576
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1576
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JAN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2b862864d3adb1a80a318ca0cc2cbbfb.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Len Zon, Harvard
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 147 Row: f Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 18858426.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1576
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_7"
FT                   /clone="MGC:77658 IMAGE:6997100"
FT                   /tissue_type="Whole, adult zebrafish"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..1576
FT                   /gene="ckma"
FT                   /note="synonyms: CK-M, cb51, wu:fa28d05, ckm"
FT   CDS_pept        85..1230
FT                   /codon_start=1
FT                   /gene="ckma"
FT                   /product="creatine kinase, muscle a"
FT                   /db_xref="GOA:Q90X19"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022413"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR036802"
FT                   /db_xref="UniProtKB/TrEMBL:Q90X19"
FT                   /db_xref="ZFIN:ZDB-GENE-980526-109"
FT                   /protein_id="AAH65844.1"
FT                   /translation="MPFGNTHNNFKLNYSVDEEYPDLSKHNNHMAKVLTKEMYGKLRDK
FT                   QTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATD
FT                   KHKTDLNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALS
FT                   SLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNEN
FT                   KTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVL
FT                   TCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNAD
FT                   RIGSSEVEQVQCVVDGVKLMVEMEKKLEKGESIDSMIPAQK"
XX
SQ   Sequence 1576 BP; 398 A; 397 C; 400 G; 381 T; 0 other;
     cctatttcgg cttggtgaac aggatctgat cccaaggact gttaccactt ttgttgtctt        60
     ttgtgcagtg ttagaaacgc aatcatgcct ttcggaaaca cccacaacaa cttcaagctg       120
     aactactcag ttgatgagga gtatccagac cttagcaagc acaacaacca catggccaag       180
     gtgctgacta aggaaatgta tggcaagctt agggacaagc agacccccac tggattcact       240
     gtggatgatg tcatccagac cggtgttgac aatccaggcc accccttcat catgaccgtc       300
     ggctgtgttg ctggtgatga ggagtcctac gaagtgttca aggatctgtt cgaccccgtc       360
     atttccgacc gtcacggtgg atacaaggca actgacaagc acaagaccga cctcaacttt       420
     gagaacctga agggtggtga tgacctggac cccaactacg tcctgagcag ccgtgtgcgt       480
     accggacgca gcatcaaggg atacgccctg cccccccaca acagccgtgg agagcgcaga       540
     gctgtggaga agctgtctgt tgaagctctg agtagcttgg atggagagtt caagggcaag       600
     tactaccccc tgaagtccat gactgatgcc gagcaggagc agctgatcgc tgaccacttc       660
     ctctttgaca aacccgtctc ccccctgctg ctggctgctg gtatggcccg tgactggccc       720
     gatgccagag gcatttggca caatgagaac aagaccttcc tggtctgggt gaacgaggag       780
     gatcacctgc gtgtcatttc catgcagaag ggtggcaaca tgaaggaagt gttcaagcgc       840
     ttctgcgttg gtcttcagag gattgaggaa attttcaaga agcacaacca tgggttcatg       900
     tggaacgagc atcttggttt cgtcctgacc tgcccctcca acctgggcac aggcctgcgc       960
     ggtggagtcc acgtcaagct gcccaagctc agcacacatg ccaagtttga ggagatcctg      1020
     accagactgc gcctgcagaa gcgtggcaca gggggtgtgg acaccgcctc cgttggtgga      1080
     gtgtttgaca tttccaacgc tgaccgtatc ggctcttcag aggttgagca ggtgcagtgt      1140
     gtggttgatg gtgtcaagct gatggtggag atggagaaga agctggagaa gggcgagtcc      1200
     atcgacagca tgatccctgc ccagaagtaa agcgggagct cttccatttt tttctcgtct      1260
     ttgtctgttt ttttacagtc caacagcaac gcagaggaaa actgctgctc aaaaagacag      1320
     tctcaccttt gcacctgtct tctttccttt ttttcccttc ttctctaatt tccatgtcat      1380
     ttcgccatct ttttttccac tttgtttcct attaagtcgg taacatcttg ggatcagata      1440
     cccggcgcag gagtgagtgc ctgttgctga ggcttcacct caatttcagc cttggttgta      1500
     aaaagtgaat caatcaaagt tgtatttcaa taaaaatacc ccataaaaaa aaaaaaaaaa      1560
     aaaaaaaaaa aaaaaa                                                      1576
//

If you have problems or comments...

PBIL Back to PBIL home page